KEGG   Sporosarcina sp. P33: SporoP33_08335Help
Entry
SporoP33_08335    CDS       T04790                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
spor  Sporosarcina sp. P33
Pathway
spor00380  Tryptophan metabolism
spor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    SporoP33_08335
Enzymes [BR:spor01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     SporoP33_08335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase Hs1pro-1_C
Motif
Other DBs
NCBI-ProteinID: ARD48234
Position
complement(1670397..1671215)
Genome map
AA seq 272 aa AA seqDB search
MKEKGIHTDFRESMTYGEYLHLDSVLSSQRRLSGHHDEMLFIIIHQVSELWMKLILHELE
TAIELIQQDELPEAFKMLARVSKVQSQIIQAWDVLATLTPAEYMEFRDSLGRASGFQSYQ
NRLIEFALGYKQPQIIQIYEKEPELSARLAKAYKAPGIYDVSIRALQRAGFTINPKVLAR
DFSTAYAGDPSVAAAWLEVYRDVDGYWELYQLAEKLVDIEDSHQQWRFRHMKTVERIIGF
KQGTGGSSGVHYLKSVLDHRFFPELWDVRTKI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaagggcattcatacggatttccgggagtcgatgacatatggtgaatatctg
catttagatagcgtattatcgagccagaggcgtttatccggccaccacgatgaaatgctg
tttattattattcatcaggtaagcgaactatggatgaaactgattttgcatgagctggag
actgcgatcgaattaatacagcaagatgaattaccggaagcattcaaaatgctggcgcgt
gtatcgaaagttcaatcacagattatccaggcatgggatgttctggctacactgacgcct
gctgagtatatggaattccgcgacagtcttggccgggcatctggttttcagtcctatcag
aaccgtttgatagaatttgctttaggttataaacagccgcagatcattcagatatacgaa
aaggaaccagaattgtcagcccgattggcgaaagcatacaaggcgcccggaatctatgac
gtttcgattcgggcgctccagcgcgcgggtttcacgattaatccaaaggttcttgcacgc
gacttttccactgcgtatgcaggtgatccaagtgtggcggcagcctggctggaagtctac
cgtgatgtcgacgggtactgggagctgtaccagctggctgaaaaattggtggatatcgaa
gacagccatcagcagtggcgtttcagacatatgaaaactgtggaaagaattattggtttc
aagcagggaacaggcgggtcttcgggtgtgcattatttgaaatctgtgcttgatcaccgc
ttcttccccgagctatgggatgtgcgtactaaaatttga

DBGET integrated database retrieval system