KEGG   Sporosarcina sp. PTS2304: DV702_13735Help
Entry
DV702_13735       CDS       T05572                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
spos  Sporosarcina sp. PTS2304
Pathway
spos00480  Glutathione metabolism
spos00590  Arachidonic acid metabolism
spos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    DV702_13735
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DV702_13735
Enzymes [BR:spos01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DV702_13735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AXI00685
UniProt: A0A345P076
Position
2866960..2867442
Genome map
AA seq 160 aa AA seqDB search
MTTVYDFTVQTTDGGQQTLQQYDGHPMIIVNTASKCGFIKQFKELQQLYEEYKDQGLVIL
GFPSDNFNNQEFDNIEETLNLCQVNYGVTFPMFAKIDVKGDNADPLFTYLTEQQKGLLTE
GIKWNFTKFLIDPNGQVVERFAPQTNPLKMQKSIEKLFIE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgtttatgattttaccgtacaaactacggatggaggacaacaaacacttcaa
caatatgatggacatcctatgataattgtcaatacagcaagtaaatgtggcttcataaaa
caatttaaagaacttcaacagctgtacgaagaatataaagatcagggacttgtaatacta
ggctttccttcagataactttaataaccaagaatttgataatatagaagaaaccttgaat
ctttgccaagttaactacggtgttacctttcctatgtttgctaagatagatgtaaaagga
gataatgcagaccctttatttacttatttaactgagcaacaaaaaggattgttaactgaa
gggattaaatggaactttacaaagtttctaatagatcctaacggtcaagttgtcgagcgt
tttgcgccacaaaccaatccgttgaaaatgcagaaatcaattgaaaaactatttattgaa
taa

DBGET integrated database retrieval system