KEGG   Streptococcus pneumoniae P1031 (serotype 1): SPP_1313Help
Entry
SPP_1313          CDS       T00874                                 

Gene name
carB
Definition
(GenBank) carbamoyl-phosphate synthase, large subunit
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
spp  Streptococcus pneumoniae P1031 (serotype 1)
Pathway
spp00240  Pyrimidine metabolism
spp00250  Alanine, aspartate and glutamate metabolism
spp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPP_1313 (carB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPP_1313 (carB)
Enzymes [BR:spp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     SPP_1313 (carB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 ATP-grasp_3 ATP-grasp Dala_Dala_lig_C MGS ATPgrasp_Ter GARS_A ATP-grasp_4 RimK ATP-grasp_5 YozD
Motif
Other DBs
NCBI-ProteinID: ACO21160
UniProt: C1CL09
Position
complement(1229534..1232710)
Genome map
AA seq 1058 aa AA seqDB search
MPKRTDIQKIMVIGSGPIIIGQAAEFDYAGTQACLSLKEEGYEVVLVNSNPATIMTDKEI
ADKVYIEPITLEFVTRILRKERPDALLPTLGGQTGLNMAMELSKNGILDELSVELLGTKL
SAIDQAEDRDLFKQLMEELEQPIPESEIVNTVEEAVAFAATIGYPVIVRPAFTLGGTGGG
MCANEKELREITENGLKLSPVTQCLIERSIAGFKEIEYEVMRDSADNALVVCNMENFDPV
GIHTGDSIVFAPAQTMSDYENQMLRDASLSIIRALKIEGGCNVQLALDPNSFKYYVIEVN
PRVSRSSALASKATGYPIAKLAAKIAVGLTLDEVINPVTGSTYAMFEPALDYVVAKIPRF
PFDKFEKGERRLGTQMKATGEVMAIGRNIEESLLKACRSLEIGVHHNEIPELAAVSDDAL
IEKVVKAQDDRLFYVSEAIRRGYTPEEIAELTKIDIFYLDKLLHIFEIEQELGAHPQDLE
VLKTAKLNGFSDRKIAELWGTTDDKVRQLRLENKIVPVYKMVDTCAAEFDSETPYFYSTY
GWENESIRSDKESVLVLGSGPIRIGQGVEFDYATVHSVKAIQAAGYEAIIMNSNPETVST
DFSVSDKLYFEPLTFEDVMNVIDLEQPKGVIVQFGGQTAINLAEPLAKAGVTILGTQVAD
LDRAEDRDLFEQALKELDIPQPPGQTATNEEEAALAARKIGFPVLVRPSYVLGGRAMEIV
ENEEDLRSYMRTAVKASPDHPVLVDSYIVGQECEVDAISDGKDVLIPGIMEHIERAGVHS
GDSMAVYPPQTLSQKVQETIADYTKRLAIGLHCLGMMNIQFVIKDEKVYVIEVNPRASRT
VPFLSKVTNIPMAQVATKLILGQSLSELGYQNGLYPESTRVHIKAPVFSFTKLAKVDSLL
GPEMKSTGEVMGSDATLEKALYKAFEASYLHLPTFGNVVFTIADDAKEEALNLARRFQNI
GYGILATEGTAAFFASHGLQAQPVGKIGDDDKDIPSFVRKGRIQAIINTVGTKRTADEDG
EQIRRSAIEHGVPLFTALDTANAMLKVLESRSFVTEAI
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaacgtactgatattcaaaaaattatggtgattggttctggtccgattattatt
ggtcaggctgctgagtttgactatgctgggacccaggcttgcttgtcgttgaaagaggaa
ggttatgaggttgttttggttaactcaaatcctgcaaccatcatgacggacaaggaaatt
gctgacaaggtttacattgaaccgattacacttgagtttgtgacacgtattcttcgtaag
gaacgtccagatgccttgctaccaacactcggtggtcagacaggtctcaacatggccatg
gaattgtctaaaaatggtatcttagatgagcttagcgttgaacttctgggtactaaattg
tctgccattgaccaagcggaggaccgtgacctctttaaacaattgatggaagagcttgag
caacccattccagaatctgaaattgttaacacagtagaagaagcagttgcctttgcagcg
acaattggctacccagtcatcgttcgtccagcctttacccttggtggtactggtggtggt
atgtgtgccaacgagaaagaattgcgtgaaatcactgaaaatggtttgaaattgtcacct
gttacccaatgtttgattgagcgttcgattgctggtttcaaggaaattgaatacgaagtg
atgcgtgactcagctgacaatgccttggttgtttgtaacatggaaaactttgacccagtt
gggattcacacgggggattccattgtatttgcccctgcgcaaaccatgtcagactatgaa
aaccaaatgcttcgtgatgcgagcttgagcattattcgtgccctcaagattgaaggtgga
tgtaatgttcagctagctcttgatcctaacagcttcaagtattatgttatcgaagtaaac
cctcgtgtatcacgttcgtcagcccttgcttctaaagcgacaggatatccgattgctaag
ttggctgccaagattgcagtaggtttgaccttggatgaggttataaacccagttacaggt
tcaacctatgccatgtttgaaccagcccttgactacgtagttgctaagattccacgtttc
ccatttgacaagtttgaaaagggtgaacgccgtctcggtacacaaatgaaggcgactgga
gaagtcatggcaatcggtcgtaacatcgaggaatctcttctcaaggcctgccgctccctt
gaaattggggtgcaccacaatgaaatacctgaacttgcagcagtttctgatgatgccttg
attgaaaaggttgtcaaagcccaagatgaccgtctcttctacgtatcagaagcaattcgt
cgtggctacacacctgaagaaattgcagagcttacaaaaattgatatcttctatcttgat
aaactcttgcatatctttgaaattgagcaagaattgggtgctcatccacaagatctagaa
gttttgaaaacagccaaacttaatggtttttcagaccgtaagattgctgaactctgggga
acgactgatgataaagttcgccaacttcgcttggaaaacaagattgttccagtttataag
atggtagacacttgtgcggcagagttcgactccgaaacgccatatttctattcaacctat
ggttgggaaaatgaatctatcagatctgataaagaatctgtacttgtcctaggttcaggt
ccaatccgtatcggtcaaggggttgagtttgactacgcaaccgttcactctgttaaggct
atccaggcagctggttatgaagctatcatcatgaactcaaacccagagaccgtttcaaca
gacttctctgtatcagataagctttactttgagccattgacattcgaagatgttatgaac
gtcattgacttggaacaaccaaagggagttatcgttcagttcggtggtcaaacagccatc
aaccttgcggagccattggcaaaagcaggtgtgaccatccttggtacacaggttgctgac
ctagaccgtgccgaagaccgtgacctcttcgagcaagctctcaaagaattggatattcca
cagccaccaggacaaacggctaccaatgaagaagaagcagctcttgcagctcgtaagatt
ggcttcccagttcttgtccgcccatcttatgtacttggtggacgtgccatggaaatcgtt
gaaaacgaagaagaccttcgttcttacatgcgaactgctgttaaggctagtccagatcac
ccagttcttgtcgactcttatatcgttgggcaagagtgcgaagttgatgccatttcagat
ggtaaagatgtgctcattcctggtatcatggagcatatcgaacgtgctggtgtccactca
ggtgactcaatggctgtttacccaccacaaaccttgtcgcaaaaggttcaggagaccatc
gcagactacaccaaacgcttagcaatcggtcttcactgccttggaatgatgaacatccag
tttgttatcaaggatgaaaaagtctacgttattgaggtcaatccacgtgccagccgtact
gttccattcctatctaaggtaaccaatattcctatggctcaagtagcgaccaagctcatt
cttggtcaaagtttatcagaacttggctaccaaaatggactttaccctgaaagcacccgt
gttcatatcaaggcacctgtcttctcctttaccaaactagctaaggtagacagcttgctc
ggtcctgaaatgaagtcaacaggtgaagttatgggttctgatgctactttggaaaaagct
ctctataaagcctttgaagcttcttatctacacttgccaacttttggtaatgtcgtcttt
accatcgctgatgatgccaaagaagaagccttgaacttggctcgtcgtttccaaaacatt
ggttatggaatccttgcgacagaagggacagcagccttctttgctagtcatggcttgcaa
gcccaacctgttggtaagattggtgatgacgataaggatatcccaagttttgtacgcaaa
ggaagaattcaagctatcattaacacagtaggaacaaaacgaactgctgacgaagatggt
gagcaaattcgtcgttcagccattgaacacggggtgcccctcttcacagcgctagataca
gctaatgccatgcttaaggtacttgaaagtcgtagctttgttacagaagcgatttaa

DBGET integrated database retrieval system