KEGG   Streptococcus pneumoniae P1031: SPP_1597Help
Entry
SPP_1597          CDS       T00874                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spp  Streptococcus pneumoniae P1031
Pathway
spp00010  Glycolysis / Gluconeogenesis
spp00051  Fructose and mannose metabolism
spp00562  Inositol phosphate metabolism
spp01100  Metabolic pathways
spp01110  Biosynthesis of secondary metabolites
spp01120  Microbial metabolism in diverse environments
spp01130  Biosynthesis of antibiotics
spp01200  Carbon metabolism
spp01230  Biosynthesis of amino acids
Module
spp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spp_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPP_1597 (tpiA)
   00051 Fructose and mannose metabolism
    SPP_1597 (tpiA)
   00562 Inositol phosphate metabolism
    SPP_1597 (tpiA)
Enzymes [BR:spp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPP_1597 (tpiA)
Exosome [BR:spp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPP_1597 (tpiA)
  Exosomal proteins of bladder cancer cells
   SPP_1597 (tpiA)
  Exosomal proteins of melanoma cells
   SPP_1597 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACO20996
Structure
PDB: 

Position
complement(1478686..1479444)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAVAKGSNL
KVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagttgcatcaaaacttccttcatcagatctggttgaagcaggt
atcgctgctccagctcttgatttgacaactgttcttgctgttgcaaaaggctcaaacctt
aaagttgctgctcaaaactgctattttgaaaatgcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactacgttgttatcggtcactcagaacgccgt
gactacttccatgaaactgacgaagatatcaacaaaaaagcaaaagcaatctttgcgaac
ggtatgcttccaatcatctgttgtggtgaatcacttgaaacttacgaagctggtaaagct
gctgaattcgtaggtgctcaagtatctgctgcattggctggattgactgctgaacaagtt
gctgcctcagttatcgcttatgagccaatctgggctatcggtactggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctgctgactttggt
caagaagtcgcagacaaagttcgtgttcaatacggtggttctgttaaacctgaaaatgtt
gcttcatacatggcttgcccagacgttgacggtgcccttgtaggtggtgcgtcacttgaa
gctgaaagcttcttggctttgcttgactttgtaaaataa

DBGET integrated database retrieval system