KEGG   Streptococcus pneumoniae P1031: SPP_1674Help
Entry
SPP_1674          CDS       T00874                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (phosphoglyceromutase) (pgam) (bpg-dependent pgam) (dpgm)
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
spp  Streptococcus pneumoniae P1031
Pathway
spp00010  Glycolysis / Gluconeogenesis
spp00260  Glycine, serine and threonine metabolism
spp00680  Methane metabolism
spp01100  Metabolic pathways
spp01110  Biosynthesis of secondary metabolites
spp01120  Microbial metabolism in diverse environments
spp01130  Biosynthesis of antibiotics
spp01200  Carbon metabolism
spp01230  Biosynthesis of amino acids
Module
spp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spp_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPP_1674
  Energy metabolism
   00680 Methane metabolism
    SPP_1674
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPP_1674
Enzymes [BR:spp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SPP_1674
Membrane trafficking [BR:spp04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SPP_1674
Exosome [BR:spp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SPP_1674
  Exosomal proteins of melanoma cells
   SPP_1674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACO21602
UniProt: C1CLZ5
Position
complement(1549615..1550307)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIKFDQAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPNMDRDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFEFDEKLNVVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccacggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggtacacaacaagcgattgacgctggt
aaattgatcaaagaagctggtatcaaatttgaccaagcttacacttcagtattgaaacgt
gctatcaaaacaactaacttggctcttgaagcttctgaccaattgtgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtaaaaataaagctgaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgtattg
cctccaaatatggaccgtgatgatgagcactcagctcacacagaccgtcgttatgcttca
cttgacgactcagtaatcccagatgctgaaaacttgaaagtgactttggaacgtgctctt
ccattctgggaagataaaatcgctccagctcttaaagatggtaaaaacgtattcgtagga
gctcacggtaactcaatccgtgcccttgtaaaacacatcaaaggtttgtcagatgacgag
atcatggacgtggaaatccctaacttcccaccattggtattcgaattcgacgaaaaattg
aacgtcgtttctgaatactaccttggaaaataa

DBGET integrated database retrieval system