KEGG   Streptococcus pneumoniae P1031 (serotype 1): SPP_2217Help
Entry
SPP_2217          CDS       T00874                                 

Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
spp  Streptococcus pneumoniae P1031 (serotype 1)
Pathway
spp00051  Fructose and mannose metabolism
spp01100  Metabolic pathways
spp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SPP_2217
Enzymes [BR:spp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SPP_2217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ACO22156
Structure
PDB: 

Position
complement(2035440..2036078)
Genome map
AA seq 212 aa AA seqDB search
MSDVKQELIKYGKKLVETDLTKGTGGNLSVFDREKQLMAITPSGIDFFEIKESDIVVMDI
NGNVVEGERLPSSEWYMHLIQYQTRDDIDAIIHAHTTYATVLACLREPLPASHYMIAVAG
KDVRVAEYATYGTKELAVNAAKAMEGRRAVLLANHGILAGAQNLLNAFNIVEEVEYCAKI
YCLAKNFGEPVVLPDEEMELMAEKFKTYGQRK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaaaacaagaattaattaaatatggtaagaagctagtagaaacagatttg
acgaaaggaacaggtgggaatctcagcgttttcgatcgtgaaaaacaattgatggcaatt
accccgtcgggtattgatttctttgaaatcaaagaatccgatattgtagtgatggatatt
aatggaaatgttgtagagggagaacgcttgccatctagcgaatggtatatgcatttgatt
caatatcaaactcgtgatgatatcgatgcaattatccatgctcatacaacttatgcaaca
gtattagcttgtctcagagaaccacttccagcgagtcattatatgattgcagtggcaggg
aaagatgttcgggtagctgagtatgcaacatatggcacgaaagaattggctgtgaatgca
gctaaagcaatggaaggtcgtagagcagttttactagcgaatcatggaattttagcaggt
gcacaaaatttattgaatgcatttaatattgttgaagaagttgaatattgtgcaaaaatt
tattgtttagctaagaattttggagagccagtagttcttcctgatgaggagatggaattg
atggcagaaaaatttaaaacatacggtcagagaaaatag

DBGET integrated database retrieval system