KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_00398
Entry
SPAB_00398        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K07751  PepB aminopeptidase [EC:3.4.11.23]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00480  Glutathione metabolism
spq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SPAB_00398
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spq01002]
    SPAB_00398
Enzymes [BR:spq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.23  PepB aminopeptidase
     SPAB_00398
Peptidases and inhibitors [BR:spq01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   SPAB_00398
SSDB
Motif
Pfam: Peptidase_M17 DUF3663
Other DBs
NCBI-ProteinID: ABX65833
UniProt: A9N1Y3
Position
365674..366957
AA seq 427 aa
MTEAMKITLSTQPADARWGDKATYSINNDGITLHLNGKDDLGLIQRAARKIDGLGIKQVA
LTGEGWDTERCWAFWAGYKGPKGVRTVMWPDLDDAQRQELDNRLTIIDWVRDTINAPAEE
LGPEQLAQRAVDLLCSVACDSVTYRITKGEDLREQNYMGLHTVGRGSERPPVLLALDYNP
TGDKDAPVYACLVGKGITFDSGGYSIKQSAFMDSMKSDMGGAATVTGALAFAITRGLNKR
VKLFLCCADNLISGNAFKLGDIIRYRNGKNVEVMNTDAEGRLVLADGLIDASAQHPQLII
DMATLTGAAKTALGNDYHALFSFDDTLAGRLLTSAAQENEPFWRLPLAEFHRNQLPSNFA
ELNNTGSAAYPAGASTAAGFLSHFVENYREGWLHIDCSATYRKAPVEQWAAGATGLGVRT
IANLLTA
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgacagaagctatgaaaattacgctttccacgcagcctgccgatgcgcgctggggcgat
aaagccacttacagtattaataacgacggtattaccttgcatcttaacggtaaagacgat
ctggggttgatccagcgtgcggcgcgtaaaatcgacggcctgggaataaaacaggtagcg
ctgacaggcgaaggatgggataccgagcgttgttgggcattctgggcgggttacaaagga
ccaaaaggcgtccgtaccgtaatgtggccggatttagacgatgcccaacgtcaggaactg
gataaccgcctgaccattattgactgggtgcgcgacaccattaatgctccggcggaagag
cttgggccggagcaactggcgcagcgcgcggtggatctgctgtgcagcgtcgcgtgcgat
agcgtcacttaccgtatcaccaaaggcgaagatctgcgcgagcagaactatatggggctg
cataccgtaggccgtggttctgagcgtccgccggtgctgctggcgctggattacaacccg
acgggagacaaagatgcgccggtttacgcctgcctggtcggtaaaggtatcacctttgac
tccggcggttacagtatcaaacaaagcgcttttatggactcaatgaaatccgatatgggc
ggcgcggcgacagtaacgggcgcgctggcgttcgccattacccgtgggctgaataaacgc
gtaaaactgttcctgtgctgcgccgataatctgatcagcggcaacgcgtttaaactgggc
gatattattcgctaccgtaatggcaagaatgtcgaagtcatgaataccgatgcggaaggg
cgactggtactggcggatggcctgattgacgccagcgcgcaacacccgcagctaatcatt
gatatggcgacgttaaccggcgcggcgaaaacagcgctgggtaacgactaccatgcgcta
ttcagttttgacgatacgctggcggggcgcttgttgaccagcgcggcgcaagaaaatgaa
ccgttctggcgtctgccgctggcggagttccaccgtaaccagctgccgtctaactttgcg
gaactgaacaacaccggcagcgcggcttatcccgccggggcaagcaccgccgcaggtttt
ctgtcgcactttgttgaaaattaccgcgaaggctggctgcacattgactgttccgccact
tatcgcaaagcgccggttgagcagtgggctgccggggcaaccggtctgggtgtgcgcacc
atcgcgaatctgctgaccgcctga

DBGET integrated database retrieval system