KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_00557Help
Entry
SPAB_00557        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00010  Glycolysis / Gluconeogenesis
spq00052  Galactose metabolism
spq00500  Starch and sucrose metabolism
spq00520  Amino sugar and nucleotide sugar metabolism
spq00521  Streptomycin biosynthesis
spq01100  Metabolic pathways
spq01110  Biosynthesis of secondary metabolites
spq01120  Microbial metabolism in diverse environments
spq01130  Biosynthesis of antibiotics
spq01200  Carbon metabolism
Module
spq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPAB_00557
   00052 Galactose metabolism
    SPAB_00557
   00500 Starch and sucrose metabolism
    SPAB_00557
   00520 Amino sugar and nucleotide sugar metabolism
    SPAB_00557
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPAB_00557
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SPAB_00557
Enzymes [BR:spq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPAB_00557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: ABX65984
UniProt: A9N432
Position
526837..527802
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVVRVYLDEHSVSVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GGEPVDGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDFAPNSEEEAMILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKSDNRLPENLRPKDITERALADSCIDCRRALSLFCVI
MGRFGGDLALTMGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKDYIHGIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttagtaggagatgtaggcggcacgaatgcgcgtcttgccctgtgt
gatatcgccagtggagaaatctcgcaggccaaaacgtattccggcctggattatcccagt
cttgaggccgtggtgcgcgtttatctcgatgagcatagcgtcagcgtggaagatggttgt
atcgccatagcctgcccgattaccggtgactgggtagcgatgactaaccatacctgggct
ttttctattgcggaaatgaaaaaaaatctcggctttagccatctggaaatcatcaacgat
ttcaccgccgtgtcgatggcgatcccgatgctgaaaaaagagcatttaattcagttcggc
ggcggcgaaccggtagacggcaaacctattgcggtgtatggcgcgggaaccggcttgggc
gtggcgcatctggtgcatgtggataagcgttggattagccttccgggcgaaggcgggcat
gtcgattttgcgcctaatagcgaagaagaagctatgattctggaaatattgcgcgccgaa
attggccacgtttccgccgagcgcgtgctgtctggcccggggctggtgaatctttaccgg
gcgattgttaagtccgacaaccgtctgccggaaaatctgcgcccgaaagatattaccgaa
cgcgccctggcggatagctgtatcgattgtcgccgcgcgttgtcgctcttttgcgtcatc
atggggcgatttggcggcgatctggcgttaaccatggggacatttggcggcgtttatatc
gctggcggtattgtcccgcgcttcctggaattttttaaagcgtccggcttccgtggtggc
tttgaagataaaggccgctttaaagattatatacacggtattccggtctatctgattgtc
catgataaccctggcttgttaggctccggcgcgcatctgcgccagacattaggtcatatt
ctataa

DBGET integrated database retrieval system