KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_01493Help
Entry
SPAB_01493        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00010  Glycolysis / Gluconeogenesis
spq00071  Fatty acid degradation
spq00350  Tyrosine metabolism
spq00620  Pyruvate metabolism
spq00625  Chloroalkane and chloroalkene degradation
spq00626  Naphthalene degradation
spq00650  Butanoate metabolism
spq01100  Metabolic pathways
spq01110  Biosynthesis of secondary metabolites
spq01120  Microbial metabolism in diverse environments
spq01130  Biosynthesis of antibiotics
spq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPAB_01493
   00620 Pyruvate metabolism
    SPAB_01493
   00650 Butanoate metabolism
    SPAB_01493
  Lipid metabolism
   00071 Fatty acid degradation
    SPAB_01493
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPAB_01493
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPAB_01493
   00626 Naphthalene degradation
    SPAB_01493
Enzymes [BR:spq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPAB_01493
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SPAB_01493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: ABX66891
Position
complement(1276440..1279118)
Genome map
AA seq 892 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKEATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYMLQGQELKAVQNVILKNGALNAAIVGQP
AYKIAELAGFSVPETTKILIGEVTVVDESEPFAHEKLSPTLAMYRAKDFEEAVEKAEKLV
AMGGIGHTSCLYTDQDNQPERVAYFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSVVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESIKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRDFTEGEVAAKKDVVAAPKAEKKAKKSA
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtagagcgtgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagaacaggtcgacaaaatcttccgcgccgccgctctg
gcagccgctgatgcccgcattccgctggccaaaatggccgtcgccgaatccggtatgggt
atcgtggaagacaaagtgattaaaaaccacttcgcttctgaatatatttacaatgcttat
aaagatgaaaaaacctgcggcgtgctgtctgaagacgacaccttcgggaccatcaccatt
gctgaacctgtcggcattatttgcggtatcgttccaaccactaacccaacctctaccgcg
atcttcaaatcgctgattagcctgaagacccgtaacgccatcatcttttctccgcatccg
cgcgctaaagaagcaaccaacaaagcggcagacatcgttctgcaagcggctatcgctgcc
ggcgcgccgaaagatctgattggctggatcgatcaaccttccgtagaactgtctaatgcg
ctgatgcaccacccggatatcaacctgatcctcgccactggcggtccaggcatggttaaa
gcagcatacagctccggtaaacctgctatcggcgtaggcgcaggcaacaccccggttgtc
attgatgaaaccgcggatatcaaacgcgctgtggcgtctgttctgatgtctaaaaccttc
gataacggcgtaatctgtgcttctgaacagtctgttgtcgttgttgattccgtctatgat
gccgttcgcgaacgtttcgccagccatggcggctacatgctgcagggccaggagctgaaa
gcggttcaaaacgttatcctgaaaaatggcgctctgaacgccgctatcgtcggccagcca
gcctacaaaatcgctgaactggcaggcttctccgtaccagaaaccaccaagattctgatc
ggtgaagttacggtcgttgacgaaagcgaaccgttcgcacacgaaaaactgtctccgact
ctggcgatgtatcgtgcgaaagatttcgaagaagcggtagaaaaagcagaaaaactggtc
gctatgggcggtatcggtcacacctcctgcctgtacactgaccaggataaccagccagaa
cgcgttgcttacttcggtcagatgatgaaaaccgcgcgtatcctgatcaacaccccggcc
tctcagggtggtatcggtgacctgtacaacttcaaactcgcaccttccctgacgttgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgccgtggctctctgcccatcgcgctggatgaagtgattactgatggccacaaa
cgtgcgctcatcgtgactgaccgcttcctgttcaacaacggctacgcagaccagatcacc
tctgtgctgaaagcggctggcgttgaaaccgaagtcttcttcgaagttgaagccgacccg
acgctttccgtcgttcgcaaaggcgctgagctggctaactccttcaaaccagacgtgatc
atcgcgctgggcggtggttccccgatggacgccgcgaaaatcatgtgggtcatgtacgaa
catccggaaactcacttcgaagagctggcgctgcgctttatggacatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgccgtcaccaccacttccggt
accggttctgaagtcacaccgtttgcggttgtgaccgacgatgcaaccggtcagaaatat
ccgctggctgactacgccctgaccccggatatggcgattgtcgatgccaacctggtgatg
gatatgccgaagtccctgtgtgcgttcggtggtctggatgcggtaactcacgccctggaa
gcttacgtttccgtactggcttctgagttctctgacggtcaggctctgcaggctctgaaa
ctgctgaaagaaaacctgccggcgtcttaccacgaagggtctaaaaacccggttgcgcgt
gaacgtgttcacagtgcagcgactatcgccggtatcgcgtttgccaacgccttcctcggt
gtatgtcactccatggcgcacaaactgggctctcagttccacattccgcacggtctggcg
aacgccctgctgatttgtaacgttatccgctacaacgcgaatgacaacccgaccaagcag
accgctttcagccagtacgatcgtccgcaggcacgccgtcgttacgctgaaattgctgac
cacctgggcctgagcgcgccgggcgaccgtaccgccgctaagattgaaaaactgctggca
tggctggaaagcattaaagctgagctgggtattcctaagtctatccgtgaagcaggcgta
caggaagctgacttcctggcacacgttgacaaactgtctgaagatgccttcgatgaccag
tgcaccggcgctaacccgcgttatccactgatctccgaactgaaacagattctgctggat
acctactacggtcgtgatttcaccgaaggtgaagttgcagcgaagaaagacgtcgttgcc
gcaccgaaagcagagaaaaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system