KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_02796Help
Entry
SPAB_02796        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00020  Citrate cycle (TCA cycle)
spq00640  Propanoate metabolism
spq00660  C5-Branched dibasic acid metabolism
spq01100  Metabolic pathways
spq01110  Biosynthesis of secondary metabolites
spq01120  Microbial metabolism in diverse environments
spq01130  Biosynthesis of antibiotics
spq01200  Carbon metabolism
Module
spq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPAB_02796
   00640 Propanoate metabolism
    SPAB_02796
   00660 C5-Branched dibasic acid metabolism
    SPAB_02796
Enzymes [BR:spq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SPAB_02796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABX68168
UniProt: A9MTQ2
Position
complement(2317010..2318176)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIGKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggcaaaacaactttttgcccgctatggcttaccggcgccg
gtgggttatgcctgtactactccgcgtgaagccgaagaagccgcgtctaaaatcggtgcc
ggcccgtgggtagtgaaatgtcaggttcacgctggcggccgcggcaaagcgggcggtgtg
aaggtagtaaaaagcaaggaagagattcgcgcctttgcggaaaactggctgggcaaacgt
ctggtgacctatcaaacagacgctaatggccaaccggtaaaccagattctggttgaagcg
gcgaccgacatcggcaaagaactgtacctcggcgcggtagttgaccgtagttctcgtcgc
gtggtctttatggcgtctaccgaaggtggcgtagagatcgaaaaagtcgcggaggaaacc
ccgcatctgatccataaagtcgcgctcgatccgctgaccggcccgatgccgtatcaggga
cgggaactggcgttcaaattgggtctggaaggtaaactggtgcagcagttcaccaaaatc
tttatgggcctggcaaccattttccttgagcgcgacctggcgctaatcgaaattaatccg
ctggtgatcactaagcagggcgatctgatttgcctcgacggcaagctgggcgctgacggc
aacgcgctgttccgccagccggatctgcgtgaaatgcgtgaccagtctcaggaagacccg
cgtgaagcgcaggcagcgcagtgggaactgaactacgtcgcgctggacggcaacatcggt
tgcatggtgaacggcgcgggtctggcgatgggcaccatggacatcgttaagctgcatggc
ggcgaaccggctaacttccttgacgtgggcggcggcgcaaccaaagagcgcgtcaccgaa
gcgtttaaaattatcctctcggatgacaacgtgaaagcggttctggttaacatcttcggc
ggtatcgtccgttgtgacctgattgccgacggtatcatcggcgcggtggaagaagtgggc
gtgaacgttccggtggtggtgcgtctggaaggtaacaacgccgaactcggcgcgaagaaa
ctggctgacagtggcctgaatattattgcagcgaaaagtctgacggatgcagctcagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system