KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_05177Help
Entry
SPAB_05177        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00630  Glyoxylate and dicarboxylate metabolism
spq01100  Metabolic pathways
spq01110  Biosynthesis of secondary metabolites
spq01120  Microbial metabolism in diverse environments
spq01200  Carbon metabolism
Module
spq_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:spq00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SPAB_05177
Enzymes [BR:spq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SPAB_05177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABX70454
Position
4344240..4345544
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKMWRLLHGE
AKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPAV
VDRINNTFRRADQIQWASGIEPNDPRYVDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDADAADL
ITSDCDPYDSSFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARR
FADAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGAS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtactcaacaaatcgaagaattacagaaagagtggacacaaccgcgctgg
gaaggcatcacccgcccgtacagcgcggaggaggtggtgaaattacgcggctcggttaac
ccggaatgcacgctggcgcagctcggcgccgcgaaaatgtggcggctgttgcacggtgaa
gcgaaaaaaggctatatcaacagccttggcgcgctgactggcggtcaggcgttgcagcag
gcgaaagccggtattgaggcgatttatctttcaggctggcaggtagcggcagatgccaac
ctggcatccagcatgtatccggatcaatcgttgtacccggcaaactctgttccggcggta
gtggatcggatcaacaacactttccgtcgtgcagatcagatccagtgggcatccggtatt
gaacccaacgatccgcgctatgtggattacttcctgccgatcgttgctgatgcggaagcc
ggttttggcggcgttctgaatgccttcgaactgatgaaatcgatgattgaagccggtgca
gcggccgttcacttcgaagatcagctggcgtcggtgaagaaatgcggccatatgggcggc
aaggtgctggtccccacgcaggaggcgattcagaaactggttgctgcgcgtctggccgct
gatgtgatgggcgtcccgacgctggtgattgcgcgtaccgatgcggatgcggcagatctg
atcacctccgactgcgatccctatgacagcagttttattaccggcgaacgcaccagcgaa
ggtttctaccgcacccatgcgggcattgagcaggcgatcagccgcggtctggcgtatgcc
ccgtatgccgatctggtgtggtgcgaaacctctacgccggatctcgaactggcgcgtcgt
tttgccgatgctatccacgcgaagtatccgggcaaactgctggcctataactgttcacca
tccttcaactggcagaagaatctggacgacaagaccattgccagcttccagcagcagttg
tcggacatgggttacaaataccagtttattaccctggcgggcatccacagcatgtggttc
aacatgtttgacctggcgcatgcatacgctcagggcgagggcatgaaacactatgttgag
aaggttcaacaacccgagttcgccgcggcgaaagacggctacacctttgtttcccaccag
caggaagtgggcactggttacttcgacaaagtcaccaccattattcagggtggcgcgtca
tccgttaccgcgttaacgggttccaccgaagaatcgcagttttga

DBGET integrated database retrieval system