KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_05308Help
Entry
SPAB_05308        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K07701  two-component system, CitB family, sensor histidine kinase DcuS [EC:2.7.13.3]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPAB_05308
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spq01001]
    SPAB_05308
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:spq02022]
    SPAB_05308
Enzymes [BR:spq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SPAB_05308
Protein kinases [BR:spq01001]
 Histidine kinases
  CitB family [OT]
   SPAB_05308
Two-component system [BR:spq02022]
 CitB family
  DcuS-DcuR (C4-dicarboxylate metabolism)
   SPAB_05308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: sCache_3_2 HATPase_c PAS SPOB_a HATPase_c_5 dCache_3 HATPase_c_2 dCache_1 sCache_3_3 PAS_10 PAS_4 HATPase_c_3 PAS_9 PAS_8 PAS_7
Motif
Other DBs
NCBI-ProteinID: ABX70583
Position
complement(4475849..4477480)
Genome map
AA seq 543 aa AA seqDB search
MKHSLPCRALRKRPMKLGTTVILMVSAVLFSVLVVVHLIYFSQISSMTRDALADKALAVA
RSLADSPAVREGLKKPPAESGIQPLAEAVSQHNGFLFIVVTNMQGIRYSHPETQRIGQPF
KGDDILLALQGKENVAINRGFLAKALRVFTPVYDEHHRQIGVVAIGLELSHVTQQINNSR
GSIIWSILFGALVGLLGTYALVKVLKRILFGLEPYEISTLFEQRQAMLQSIKEGVIAVDD
SGEVTLINHAAQALLDYRKTQDDARLSTLSHAWSQVVDISEVLRDGTPRRDEEIIVKGRL
LLVNTVPVRSNGEIIGAISTFRDKTEVRQLMQRLDGMVNYADALRERSHEFMNKLHVILG
LLHLKSYKQLEAYIIKTANNYQEEIGLLLGKIKSPIIAGFLLSKITRASDFGHSLVISSD
SQLPDNNNEDQVTVLITALGNLIENALEALSQESGGEISVSLHYRHGWLHCEVSDDGPGI
EPERIEAIFEKGVSSKGAERGVGLALVKQQVEALGGVISVESEPGIFTQFFVQLPWDGKR
TSL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaaacactccctgccatgccgggcgttacgcaaacgccccatgaaactcggcactacc
gtcattctgatggtcagcgccgttttgttttcggtgctcgttgtggtccatctgatctat
ttttcgcaaatcagcagcatgacgcgcgacgcgctggcagataaagcgctggcggtggct
cgctcgctggcggactctccggcagttcgcgaggggctgaaaaaaccgcctgcggaaagc
ggcattcagccgctcgccgaagcggtgagccagcataatggctttttgtttattgtggtg
accaatatgcagggcatccgttattcgcacccagaaacgcagcgaatcggccaaccgttc
aaaggcgatgacattctgctcgcgctgcagggaaaggaaaacgttgccattaatcgcggc
tttcttgccaaagcgctgcgcgttttcacaccggtttatgatgaacaccaccggcagatc
ggcgtggtagcgattggcctggaactcagtcacgttacgcagcagatcaacaatagccgc
ggcagtattatctggtccattctgttcggcgctctggtggggttattaggcacgtatgcg
ctggtcaaggtgctgaaacgtatcctgtttggcctcgaaccctatgagatctcaaccctg
tttgaacaacgccaggcgatgctgcagtcaatcaaagagggcgttatcgccgtggatgat
agcggcgaagtcacgttgattaaccatgcggcgcaggcgctgctcgattatcgaaaaacg
caggatgacgccagattatccaccctgagtcatgcctggtcgcaggtggtggacattagc
gaagtgttgcgtgacggtacgccgcgccgcgatgaagagatcatcgtcaaaggccgcctg
ctgctggtgaataccgttccggtgcgcagcaacggcgaaattatcggcgcgatatccacc
ttcagggataaaacagaagttcgccaactgatgcagcggttggacgggatggtgaactac
gcggatgcgctccgtgaacgatcccacgaattcatgaacaaattacatgtgattctggga
ttattgcacctgaagagttataagcagcttgaagcgtatattatcaagacggccaataac
tatcaggaagagatcggtttgctgctgggtaaaataaagtcgccgattatcgctggcttt
ttgctcagtaagattacccgcgcctctgatttcgggcacagcctggtgataagcagcgac
agccagttaccggataataacaatgaagatcaggttacggtgctgattacggcgctgggt
aatttgattgaaaacgcgctggaggcattgagccaggaatccggcggcgaaatcagcgtc
tcgttacactaccgtcatggctggctgcattgcgaagtgagcgatgacggtccgggtatc
gaacctgagcgcatcgaggcgatttttgaaaaaggcgtctcgtcgaaaggcgccgaacgc
ggcgtcggtttagcgctggttaaacagcaggttgaagcgcttggcggcgtaatttccgtg
gagtccgagcctgggatcttcacacaattttttgtacagttaccctgggatggaaaaagg
accagcctatga

DBGET integrated database retrieval system