KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_05387
Entry
SPAB_05387        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_22 AAA_7
Other DBs
NCBI-ProteinID: ABX70660
UniProt: A0A6C6Z974
Position
4530803..4533619
AA seq 938 aa
MAFPLFSRRRASQDAHQYGNGPFSVSGYEPLTREGQLTHSDEARLYSTAPSIIDHVPWGE
YLPEHECILLDDGVSVGAVYEIIPVGTEGRPETRLDEICNIAENALQDSLPELDDHQWVV
QFFCQDDSDLSTYMDTIRGYVRPRAQGTAFTKAWLAEQERHLENVAVEQGLFVDEAVTGA
AWRGQIRRTRMVVYRWVETPYRDPMPPEVLLKQVCDRLTAALSGAGIRCEKQNGEQIHSW
LLRWFNPAPAWVDKKTLYRCAKHSDHAPGDLPLLNDFSESLWFTRPRSDAESGVWWFDDV
AHKAVPVARLRTAPSTGHLTGEVKRGDNVNAIMDLLPEGTVLAMTLVVQPQDKLEESFAS
LSRNSMGENVDSLRAREDAATARNFLGNKHKLYRAAITLLIKAQDKETLDKRYLDLSSKL
LNCGMEPINPEHDIGPLSSYMRALPMCFNPQMDKHNWYTRLMFVQHFACLAPIYGRDTGT
GHPGLTFWNRGGGPLSVDPLNKNDRTQNAHLLLFGPTGAGKSATALDKLAQMVAIYRPRI
FLLEAGNSFGLFGDYCNSLGLSVHRVSIKPGKVISLAPFGDSHLLMQAKPETLVTSEEAL
PDIDEDDEDKDEERDILGEMEIAARLMITGGEAAEEERMTRADRGMIREAILIAARKAFD
ENRQMLPEDLMFSLENIARDVSMGEDGREKRTPARRARAEEMAEALRMFTEGFEGELFNR
PGAQWPEADVTIVDLGTLAREGYEAQMAVAVISLLNTINNIAEREQFSDRDIIVPIDEAH
IVTANPLLGPYATKIVKMWRKLGSWLWLFTQNLEDFPDTAKKMLNMAEWWICLVMPPDEV
EQIARFKTLTEEQKAMLLSATKLPRKYTEGVILSRKVQALFRAVPPSLYLAMGMTEKEEK
AERRAIMNELNCSELEAAFHVARRLDEKRGIGTIQGTI
NT seq 2817 nt   +upstreamnt  +downstreamnt
atggctttccctctatttagccgacgtcgagcgtctcaggatgctcatcagtacggtaac
ggtccgttttccgtcagtgggtatgaaccgcttacccgggaagggcaactgactcattca
gatgaagcgcgtctgtattccactgcaccttccattatcgatcatgttccatggggcgag
tatttgccagagcatgaatgcattctgcttgacgatggtgtttcagttggggccgtatat
gagattatcccggtgggcactgaagggcgcccggaaacacgtctggacgagatctgcaat
atcgctgagaacgccctacaggacagtctccctgaactggatgatcatcaatgggtggta
cagtttttctgccaggatgactctgatctctctacttatatggatactatcagaggctat
gtcaggccaagagctcagggaaccgcattcactaaagcctggctggctgaacaggagcgc
caccttgaaaatgtggcggtggaacaggggctttttgtagacgaggctgtcacaggggcc
gcctggagagggcaaattcgcagaacgcgcatggtggtttaccgttgggttgagacaccg
tatcgtgaccccatgccaccggaggtgctgctgaaacaggtctgcgatcgcctgacagca
gctctgagcggtgccggtatccggtgcgaaaagcagaacggcgagcaaatccatagttgg
ctgttgcgctggttcaacccggcgccggcgtgggtcgataagaaaacattgtatcgttgc
gcaaaacactccgatcatgcaccgggcgatctgcctcttctgaatgatttcagcgaaagc
ctctggtttacccgcccgcgaagtgatgccgaaagcggtgtgtggtggtttgatgatgtg
gcacataaagctgttccggttgcccgcctgcgtactgcaccttccaccggtcatctgacg
ggggaggtaaaacgtggtgataatgtgaatgccattatggatctgcttccggaagggaca
gttctggccatgaccctggtggttcagcctcaggacaaacttgaagaaagttttgcgagc
ctgagccgcaattcaatgggggagaatgttgattccctgcgtgctcgtgaagacgctgct
acagcgcgtaatttcctgggaaacaaacacaaactttaccgtgcggccatcacactgctt
atcaaggctcaggacaaggaaacactcgataaacggtatcttgatctcagcagtaagtta
ctgaactgtgggatggaaccgataaatccagaacacgatattggccctctcagcagttat
atgcgtgcgttacccatgtgctttaaccctcaaatggataaacacaactggtacacgcgc
cttatgtttgtacagcattttgcatgtctcgcccctatttatggtcgtgacaccggtact
ggtcacccggggcttacgttctggaatcgtggtggtggccccctgtccgtagatccactt
aataaaaatgaccgtacccagaatgcgcacctgctgcttttcgggccgacaggtgccggt
aaatctgccactgcgctcgataaactggctcagatggtggcaatctaccgcccccgtata
tttttgctggaagcgggtaacagcttcggtctgtttggagattactgtaattcgctgggg
ctctcagtgcaccgtgtcagtatcaagcctggtaaggttatttcacttgctccgtttggc
gattcacatctgctcatgcaggcgaaacctgagacgctagtgacaagcgaagaggccctc
cctgacattgatgaagatgatgaggacaaggacgaagaacgtgacattctgggtgaaatg
gagattgcagcgcggttgatgatcaccggtggtgaagcagcagaagaggagcgaatgaca
cgcgccgaccgcggtatgattcgtgaggcgatactcattgcggctcgtaaagcgtttgac
gaaaaccgccagatgctaccggaagatttaatgttctcgcttgagaacattgcccgcgat
gtcagcatgggagaagacggccgcgagaaacgcacgccagcgcgacgtgcacgagctgaa
gagatggcagaagcattacgcatgtttaccgaaggttttgaaggggagttgtttaaccgt
ccgggcgcgcaatggccagaggcagacgtgactattgttgatttaggcacgctggcgcgt
gaaggctatgaagctcagatggccgttgctgtcatctcgctgcttaatacgattaacaat
atcgcagaaagggaacagttcagcgatcgggatatcattgtgccaatcgacgaagcgcat
attgtaactgctaacccgctgttgggcccgtatgcaaccaaaattgtcaaaatgtggcgt
aagctcggatcatggctgtggttgttcacacagaacctggaggatttccctgacactgcg
aaaaaaatgctcaatatggcggagtggtggatctgcctcgttatgccacctgatgaagtt
gaacaaatagcgcgatttaagacgctcacagaagagcagaaggcgatgctgttgtccgcg
acaaaacttccgagaaaatacacagagggagttattttgtcccgtaaggtacaggcgttg
tttcgtgcggtcccccccagtttgtacctggcgatgggaatgactgaaaaagaggaaaaa
gccgaaagacgggccattatgaatgaattaaattgctcggagcttgaggccgcatttcac
gttgcgcgccgcctcgatgagaaacgtggcattggtactattcaggggacaatatga

DBGET integrated database retrieval system