KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_05392Help
Entry
SPAB_05392        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABX70665
Position
4535677..4537071
Genome map
AA seq 464 aa AA seqDB search
MKKAGLLLIFASLPAMAADISLSSSGASVSGNAISDGLFYSIGGGSVISPPPSRNNMSRI
GINGGLSSDLMCGNFDIKTTVGNQLNGITSGFKDLMGNVIQGATGAVMSMPAMAIQRANP
GLYEMLTNGVLQAGLSFDKAMLNCQSMSKKLADYTIGNKWQQVAVSEEYKDIVATSGGDA
VSSDQKLQKATGEEGVTWVGGQKRGGKGQPAIQPTRDLAKAGYNMMNNLPVTSNSSVGSS
SCNGTACQRYKSSEEAAAAVVKVLGDRSIRTCRETSECTSGGTDNQPGSAVAGTGFSPIL
EDATKENLEQLSKLVSGELQPTTDNLSALKTGSLVVTRGVIQALRDDPDKAALVQRLAGE
LAMSDTVETALTMRRMLTTGESEPNAAEQPEAIAEGDRRIDALDRELTALRNEMELRKSI
SNNSLLTALERQGTRNQDNRLQQKAGNEDQGFSQMGQSQSSGAN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcaggacttttactgatttttgcctcgttgccagcaatggcagctgatatc
tctttgtcttcatcgggggcgtcagtgagcggtaacgctatcagcgatgggctcttttat
tctattggtggcggttcggttatttcacccccgcctagtcgtaacaatatgtccaggata
ggcattaatggtggccttagcagtgatctgatgtgtggcaatttcgacatcaaaacaacc
gttggcaaccagctgaatggtattaccagcgggtttaaggatctgatggggaatgtgatt
cagggggcgactggtgctgtcatgagtatgccggcaatggctattcagcgcgcaaacccc
gggctgtatgaaatgctcaccaatggcgttctgcaggccggtttgagctttgataaagcg
atgttgaactgtcagagcatgtcgaagaagctggctgattataccattggcaataaatgg
cagcaggtagccgtctctgaagagtacaaagatattgtggccacaagtggtggcgatgcg
gtttccagcgaccagaaactgcaaaaagcaactggagaggaaggcgtgacgtgggtcggt
gggcagaaaaggggaggtaaggggcagcccgcaattcaacccactcgggatctggccaaa
gctggttataacatgatgaataatttgccagtgaccagtaacagcagcgtcggctcctcg
agctgcaatggtaccgcatgccaacgttataaatcttctgaagaggccgcagcggccgtt
gttaaagtgcttggtgatcgctccatcaggacttgccgggaaaccagtgaatgtaccagt
ggtggaaccgataaccagccgggcagtgctgtcgctggtactggcttttctcccatcctt
gaggatgccacgaaagagaatctggagcagcttagtaagctggttagtggtgaactgcag
cccaccactgataacctttccgcactgaaaaccggcagtctggttgtcacccgcggggta
attcaggcattacgtgacgatccagacaaagcggccctggttcaacggcttgccggcgaa
ctggcgatgtccgacaccgttgaaaccgcgctaacaatgcgcaggatgctcaccaccggt
gaatccgaacctaatgctgcagagcagccggaagctattgccgagggtgatcgccgcatc
gatgccctcgatcgcgagctgacggcgctgcgtaatgagatggagttacgcaaatctatc
agcaataacagcctgctgacggcactggaacggcagggaacaaggaatcaggataaccgt
ctgcagcagaaagccggtaacgaggaccagggcttcagccagatgggccagtctcagtct
tccggagcaaactga

DBGET integrated database retrieval system