KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_05614Help
Entry
SPAB_05614        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00240  Pyrimidine metabolism
spq00250  Alanine, aspartate and glutamate metabolism
spq01100  Metabolic pathways
Module
spq_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:spq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPAB_05614
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPAB_05614
Enzymes [BR:spq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SPAB_05614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABX70883
UniProt: A9N659
Position
complement(4720684..4721748)
Genome map
AA seq 354 aa AA seqDB search
MCTTFCLTASEKRRRPAVFLSVENQYQAPQLRGFFLPRRQEINMANPLYQKHIISINDLS
RDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSFETSMHRLGASVVGFSDS
ANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSGQVPVLNAGDGSNQHPT
QTLLDLFTIQETQGRLDNLHIAMVGDLKYGRTVHSLTQALAKFSGNRFYFIAPDALAMPQ
YILDMLDEKGMAWSLHGSIEEVMADVDILYMTRVQKERLDPSEYANVKAQFVLRASDLNG
ARENMKVLHPLPRIDEITTDVDKTPHAWYFQQAGNGIFARQALLALVLNSELSL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtacgacattctgtcttaccgcgtctgaaaaaagacgcaggcctgccgtttttctt
tccgttgaaaaccaataccaagcccctcaattgaggggcttttttttgcccaggcgtcag
gagataaacatggctaacccgctatatcaaaaacatatcatttccataaacgacctcagc
cgcgacgatcttaatctggtactggcgacggcggcgaaattaaaagccaacccgcagccg
gagcttttgaaacataaagtgatcgccagctgctttttcgaagcctccacgcgtacccgc
ctgtcgtttgaaacttcaatgcatcgcctgggcgccagcgtagtgggcttctccgacagc
gccaacacgtcgctggggaaaaaaggagaaacgttagccgacacgatctcagtgattagc
acttacgtggacgcgattgtgatgcgccatccgcaagaaggcgcggcacgtctggcgacg
gagttttccggtcaggtgccggtgctcaatgcgggcgacggttcgaatcagcatccgacg
caaaccctgttggatctgttcaccatccaggaaacgcagggccgtctggataacctgcat
atcgcgatggtcggcgatctgaaatatggccgcaccgtgcattcgctaacccaggcgctg
gcgaaatttagcggcaaccgtttttattttatcgcgccggacgcgctggcgatgccgcag
tacattctggatatgcttgatgaaaaagggatggcctggagcctgcatggttctattgaa
gaggtcatggccgacgtcgacatcctctatatgactcgcgtacagaaagagcgtctcgac
ccgtcggagtacgccaatgtgaaggcgcagtttgttctgcgcgccagcgacctgaacggc
gcgcgtgaaaatatgaaagtgctgcacccgctgccgcggattgatgaaatcaccacggat
gtggataaaacgccacacgcctggtacttccaacaggcgggcaacggtattttcgctcgc
caggcgttactggcgttagtactgaatagcgaactgagtctgtaa

DBGET integrated database retrieval system