KEGG   Streptococcus pneumoniae R6 (avirulent): spr0048Help
Entry
spr0048           CDS       T00060                                 

Gene name
purM
Definition
(RefSeq) phosphoribosylaminoimidazole synthetase
  KO
K01933  phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
spr00230  Purine metabolism
spr01100  Metabolic pathways
spr01110  Biosynthesis of secondary metabolites
spr01130  Biosynthesis of antibiotics
Module
spr_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    spr0048 (purM)
Enzymes [BR:spr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     spr0048 (purM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS DUF4423
Motif
Other DBs
NCBI-GeneID: 933451
NCBI-ProteinID: NP_357642
UniProt: Q8DRM4
Position
51793..52815
Genome map
AA seq 340 aa AA seqDB search
MTNKNAYAQSGVDVEAGYEVVERIKKHVARTERAGVMGALGGFGGMFDLSKTGVKEPVLI
SGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLYFLDYVATGKNEPAKLEQ
VVAGVAEGCVQAGAALIGGETAEMPGMYGEDDYDLAGFAVGVAEKSQIIDGSKVVEGDVL
LGLVSSGIHSNGYSLVRRVFADYTGEEVLPELEGKKLKEVLLEPTRIYVKAVLPLIKEEL
VNGIAHITGGGFIENVPRMFADDLAAEIDESKVPVLPIFKALEKYGQIKHEEMFEIFNMG
VGLMLAVSPENVERVKELLDEAVYEIGRIVKKENESVIIK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaaaatgcatatgcccagtcgggtgtggatgttgaagcgggttatgaagtt
gttgaacggattaaaaagcacgtggcccgtacggagcgtgcaggtgtcatgggagctctt
ggtggctttggtggtatgtttgacctttccaagactggggttaaagaacccgtcttgatt
tcagggactgacggtgtcggaaccaagctcatgttggctatcaagtacgacaagcacgat
accatcgggcaggactgtgtggccatgtgtgtcaacgacatcattgctgcaggtgcggaa
cccctctattttctcgactacgtagcgacagggaagaatgaaccagctaagctagaacaa
gtggttgctggtgtggcagaaggttgtgtgcaggctggtgctgccctcatcggtggggaa
acggctgaaatgccgggcatgtacggcgaagacgactatgacttggctggttttgcggtc
ggtgtggctgaaaaatctcaaatcattgacggttcaaaggtggtagagggagatgttctt
ctcggacttgtttcaagtgggattcactcaaatggttactctttggttcgtcgtgtcttt
gcggattacacaggtgaggaagtcctaccagaattggaaggcaagaaacttaaggaagtt
ctacttgagccgactcgtatctatgtcaaggctgtcttgccgctcatcaaagaagagttg
gtcaacggcattgcccacatcacaggtggtggctttatcgaaaatgtccctcgtatgttt
gcagatgacctagctgctgaaattgatgaaagcaaagttccagtgcttccaattttcaaa
gcccttgaaaaatatggtcagattaaacacgaagaaatgtttgaaatcttcaatatgggt
gtgggacttatgttggcggtcagccctgaaaatgtagagcgtgtaaaagaattgttggat
gaagcagtctatgaaattggtcgcatcgtcaagaaagaaaacgaaagtgtcattatcaaa
tga

DBGET integrated database retrieval system