KEGG   Streptococcus pneumoniae R6 (avirulent serotype 2): spr0201Help
Entry
spr0201           CDS       T00060                                 

Gene name
rplE
Definition
(RefSeq) 50S ribosomal protein L5
  KO
K02931  large subunit ribosomal protein L5
Organism
spr  Streptococcus pneumoniae R6 (avirulent serotype 2)
Pathway
spr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:spr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    spr0201 (rplE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:spr03011]
    spr0201 (rplE)
Ribosome [BR:spr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    spr0201 (rplE)
  Bacteria
    spr0201 (rplE)
  Archaea
    spr0201 (rplE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L5_C Ribosomal_L5 H-kinase_dim
Motif
Other DBs
NCBI-GeneID: 932791
NCBI-ProteinID: NP_357795
UniProt: Q8CWV4
Position
201623..202165
Genome map
AA seq 180 aa AA seqDB search
MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAVSNAKSLEKAAEELAL
ISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKLVSVSLPRVRDFHGVPT
KSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGLDIVIVTTANTDEESRALLTGLGMPFAK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcgtttaaaagaaaaatatcttaatgaagtagttcctgctttgacagaacaa
ttcaactactcatcagtgatggctgtgcctaaagtagataagattgttttgaacatgggt
gttggtgaagctgtatcaaacgctaaaagccttgaaaaagctgctgaagaattggcactt
atctcaggtcaaaaaccacttatcactaaagctaaaaaatcaatcgccggcttccgtctt
cgtgaaggtgttgcgatcggtgcaaaagttacccttcgtggtgaacgtatgtacgaattc
ttggataaattggtatcagtttcacttccacgtgtacgtgacttccacggtgttccaaca
aaatcatttgatggacgcgggaactacacacttggtgtgaaagaacaattaatcttccca
gaaatcaacttcgatgacgttgacaaaactcgtggtcttgacatcgttatcgtaacaact
gctaacactgacgaagagtcacgtgcattgcttacaggccttggaatgccttttgcaaaa
taa

DBGET integrated database retrieval system