KEGG   Streptococcus pneumoniae R6 (avirulent serotype 2): spr0234Help
Entry
spr0234           CDS       T00060                                 

Gene name
gldA
Definition
(RefSeq) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
spr  Streptococcus pneumoniae R6 (avirulent serotype 2)
Pathway
spr00561  Glycerolipid metabolism
spr00640  Propanoate metabolism
spr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    spr0234 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    spr0234 (gldA)
Enzymes [BR:spr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     spr0234 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-GeneID: 934143
NCBI-ProteinID: NP_357828
UniProt: Q8DRB7
Position
225726..226814
Genome map
AA seq 362 aa AA seqDB search
MRIFASPSRYIQGENALFENAKSILDLGNYPILLCDQLVYDIVGKRFEDYLHRYGFHIVL
ALFNGEASDNEINRVVALAEKENCDSIIGLGGGKTIDSAKAIADLIEKPVIIAPTIASTD
APVSALSVIYTDEGAFDHYLFYSKNPDLVLVDTKVISQAPKRLLASGIADGLATWVEARA
VMQANGKTMLGQQQTLAGVAIAKKCEETLFADGLQAMAACEAKVVTPALENIVEANTLLS
GLGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTLVQLLLENRPKEELDKYIEFY
KKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMPFKISPSDVAQAIIAVDAYVN
SK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagaatttttgctagtccttctagatatattcagggggaaaatgccttgtttgaaaat
gccaaatcaattttggatttgggaaattaccctattctattatgcgatcagttggtttat
gatattgttggaaaacgatttgaagattatctacataggtatggtttccatattgttctg
gcgctatttaatggtgaagcttctgacaatgaaatcaatcgagttgttgccttggctgag
aaagaaaattgtgatagtattatcggtcttggtgggggaaagacgattgatagcgcaaaa
gctattgcagatttgattgaaaagcctgttattattgctccaacaattgcatcgaccgac
gcacctgtatctgctttatctgttatttatacagatgaaggtgcatttgatcattatcta
ttttattctaaaaatccagatttagttttggttgatacaaaagttatttcacaagcccct
aagcgtttattagcgtctggtattgcagatggtttagcaacttgggttgaggcgcgtgcg
gttatgcaggcaaatggaaaaactatgttgggacaacagcaaacattggctggagttgca
attgcgaagaaatgtgaagaaacgctgtttgcagatggtttacaggctatggcagcttgt
gaagctaaagtggtgacaccagcattagaaaatattgttgaagctaatactttattgagt
ggtctaggttttgaaagtggaggattagctgcggcgcatgcaattcataatggttttact
gcattgacaggtgacattcatcatttaacacatggtgaaaaagtagcttatggaacttta
gtacaactattattggaaaatagacctaaagaagaacttgataagtatattgagttttac
aaaaaaattggtatgccaacaactctaaaagaaatgcatttggatcaagttggatatgat
gatttaataaaagttggtaaacaagcaactatggagggtgagacaattcatcagatgccg
tttaagatttcgccttcagatgttgctcaagctattatcgctgtagatgcctatgtaaat
tcaaaataa

DBGET integrated database retrieval system