KEGG   Streptococcus pneumoniae R6 (avirulent): spr0266Help
Entry
spr0266           CDS       T00060                                 

Gene name
sulA
Definition
(RefSeq) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
spr00790  Folate biosynthesis
spr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    spr0266 (sulA)
Enzymes [BR:spr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     spr0266 (sulA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-GeneID: 934662
NCBI-ProteinID: NP_357860
UniProt: P59655
Structure
PDB: 

Position
268022..268966
Genome map
AA seq 314 aa AA seqDB search
MSSKANHAKTVICGIINVTPDSFSDGGQFFALEQALQQARKLIAEGASMLDIGGESTRPG
SSYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAAGADLVNDITGLMGDEK
MPHVVAEARAQVVIMFNPVMARPQHPSSLIFPHFGFGQAFTEEELADFETLPIEELMEAF
FERALARAAEAGIAPENILLDPGIGFGLTKKENLLLLRDLDKLHQKGYPIFLGVSRKRFV
INILEENGFEVNPETELGFRNRDTASAHVTSIAARQGVEVVRVHDVASHRMAVEIASAIR
LADEAENLDLKQYK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtaaagccaatcatgcaaagacagttatttgcggaattatcaatgtaacccca
gactccttttcggacggtggtcaattttttgctcttgagcaggcactccagcaggctcgt
aaattgatagcagaaggagccagtatgctcgatatcggcggagaatcgactcggccgggc
agtagctatgttgagatagaagaggaaatccagcgtgttgttccagtgatcaaagcgatt
cgcaaggaaagtgatgtcctcatctctattgatacttggaagagccaagtagcagaggct
gctttggctgctggtgccgatctagtcaatgatatcactggtcttatgggtgatgagaaa
atgcctcatgtggtagctgaagcgagagcgcaagtggtcatcatgtttaatccagttatg
gcgcgacctcagcaccctagctcgctcatcttccctcattttggttttggtcaagctttt
acagaggaagagttagctgactttgaaacattgccaatcgaagaattgatggaggctttc
tttgaacgagcactagcgagagcggcagaagctggtattgcaccagaaaatatcctgttg
gatccaggaattggctttggtctgaccaagaaagaaaatctgcttcttttacgggacctg
gataaactacatcagaagggctatccaatctttctcggagtgtcgcgcaagcgatttgtc
atcaatatcctagaggagaatggttttgaagtcaatcctgagacagagcttggtttccgc
aatcgggacacggcttcggctcatgtaaccagtatcgctgcaagacagggtgtagaagtg
gtgcgcgtgcatgacgtagctagtcacaggatggcagttgaaattgcctctgccattcgt
ctggctgatgaagcggaaaatttagatttaaaacaatataaataa

DBGET integrated database retrieval system