KEGG   Streptococcus pneumoniae R6 (avirulent serotype 2): spr0674Help
Entry
spr0674           CDS       T00060                                 

Gene name
sodA
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
spr  Streptococcus pneumoniae R6 (avirulent serotype 2)
Brite
Enzymes [BR:spr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     spr0674 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 934215
NCBI-ProteinID: NP_358268
UniProt: P0A4J7
Position
680041..680646
Genome map
AA seq 201 aa AA seqDB search
MAIILPELPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEKHPEIGEDLEALLADV
ESIPADIRQALINNGGGHLNHALFWELMTPEKTAPSAELAAAIDATFGSFEEFQAAFTAA
ATTRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKKPILGLDVWEHAYYVKYRNVRPDY
IKAFFSVINWNKVDELYAAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctattatcttaccagaacttccatatgcatacgacgctttggaaccatacatcgat
gcggaaacaatgcatttgcaccatgacaaacaccatcaaacttatgtcaacaatgccaat
gcagctttagaaaaacaccctgaaatcggtgaagaccttgaagccttgcttgctgatgta
gaatctatcccagctgatatccgtcaagcacttatcaacaatggtggcggacacttgaac
cacgctcttttctgggaattgatgactcccgagaaaacagctccttcagcagaactggca
gcagcaatcgatgcaacatttggttcatttgaagaattccaagcagccttcactgcagca
gcaacaactcgttttggttcaggttgggcatggttggttgtcaacaaagaagggaaactt
gaagtgacttcaacagcaaaccaagacacaccaatctcagaaggtaaaaaaccaatcttg
ggcttggacgtttgggaacatgcttactacgtgaaataccgcaacgtgcgtcctgactat
atcaaagctttcttttcagtaatcaactggaataaagtagatgaattgtacgcagctgct
aaataa

DBGET integrated database retrieval system