KEGG   Streptococcus pneumoniae R6 (avirulent serotype 2): spr0696Help
Entry
spr0696           CDS       T00060                                 

Gene name
metG
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
spr  Streptococcus pneumoniae R6 (avirulent serotype 2)
Pathway
spr00450  Selenocompound metabolism
spr00970  Aminoacyl-tRNA biosynthesis
spr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    spr0696 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    spr0696 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spr01007]
    spr0696 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spr03016]
    spr0696 (metG)
Enzymes [BR:spr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     spr0696 (metG)
Amino acid related enzymes [BR:spr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   spr0696 (metG)
Transfer RNA biogenesis [BR:spr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    spr0696 (metG)
 Prokaryotic type
   Other AARSs
    spr0696 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-GeneID: 934240
NCBI-ProteinID: NP_358290
UniProt: P67581
Position
696467..698464
Genome map
AA seq 665 aa AA seqDB search
MSEKNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQK
AEEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYL
GEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDR
LVEFFKAHPEFITPDGRLNEMLRNFIEPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDA
LLNYATALGYAQDEHGNFDKFWNGTVFHMVGKDILRFHSIYWPILLMMLDVKLPDRLIAH
GWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNLPVGSDGTFTPEDYVGRINYE
LANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHMEAVDYPR
ALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVMSHLAASIRVVAHLIEPFMMETS
RAVLTQLGLEEVSSLENLSLADFPADVTVVAKGTPIFPRLNMEEEIAYIKEQMEGNKPAV
EKEWNPDEVELKLNKDEIKFEDFDKVEIRVAEVKEVSKVEGSDKLLQFRLDAGDGEDRQI
LSGIAKYYPNEQELVGKKVQIVANLKPRKMMKKYVSQGMILSAEHDGKLTLLTVDPAVPN
GSVIG
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaaaatttttatattacaacgccgatttactatccatctgggaaacttcat
atcggttctgcctacacaactatcgcatgtgatgtcctagcacgttacaaacgcctgatg
ggctacgatgtattttatctgacaggtcttgatgaacatggtcagaaaatccagcagaaa
gcggaagaagctggtattacacctcaagcctatgttgatggaatggcggttggagttaaa
gaactctggcaattactagatatctcatacgataaatttatccgtacaactgatgactac
catgaaaaagttgtcgcacaagtctttgaacgcttacttgctcaagatgatatctacttg
ggtgaatactctggttggtattcagtatcagacgaagaattctttacagaaagccagctg
gcagaagttttccgtgatgaagctggaaatgtgactggtggtattgctccatcaggtcat
gaggttgaatgggtttctgaagaatcatacttccttcgccttagcaaataccaagaccgt
ttggtcgaatttttcaaagctcatcctgaatttatcacgccagatggtcgccttaatgaa
atgctacgcaacttcatcgagccaggcttggaagatttggcggtatctcgtacaaccttt
acatggggagtgcctgtcccatcaaatccaaaacacgttgtctacgtttggattgatgcc
cttcttaactatgcgacagctcttggctacgctcaagacgaacatggtaactttgacaag
ttctggaatggaacagtcttccatatggtaggaaaagatatccttcgcttccactctatc
tactggccaatccttcttatgatgttggatgttaaattacctgatcgtttgattgcccat
ggttggtttgtcatgaaagacggaaaaatgtctaagtcaaaagggaatgtcgtttaccct
gaaatgttggtagagcgttatggactagatccacttcgttactacctcatgcgtaacctt
ccagttggttcagacggaacctttactcctgaagactatgtcggccgtatcaactatgaa
ttggctaatgaccttgggaacctccttaaccgtacggtttccatgattaataagtacttt
gatggacaaatccctgcctatgtagaaggtgtgactgaatttgatcatgttcttgctgag
gttgcagaacaatcaatcgcagacttccatacacacatggaagcagttgactatccacgt
gcgcttgaagcagtctggactctgatctctcgtaccaataaatacatcgatgagaccgca
ccatgggtcttggccaaggatgaagctcttcgtgaccaattggcaagtgtcatgagccac
ttggcagccagcattcgtgtagttgctcacttgattgaaccatttatgatggaaactagt
cgtgcagttttgactcaacttggtttggaagaagtttctagtcttgaaaacttgagtttg
gctgacttcccagcagatgtgactgtagttgccaaaggaacacctatctttccacgtcta
aatatggaagaagaaatcgcctatatcaaggaacaaatggaaggcaataaaccagcagtc
gaaaaagaatggaatccggacgaagttgagctcaaactaaacaaggatgaaatcaagttt
gaagactttgacaaggttgaaatccgtgtcgcagaagtcaaagaagtgtctaaagtagaa
ggttcagataagttgcttcaattccgcttggatgctggtgatggagaagatcgtcagatt
ctttcaggaattgcaaaatactatccaaatgaacaagaattggtcggcaagaaagttcaa
atcgttgctaacctcaaaccacgtaaaatgatgaaaaaatatgtcagccagggtatgatt
ctctcagctgaacatgatggcaaattaacccttctcacagttgatccagctgtaccaaat
ggaagtgtgattgggtaa

DBGET integrated database retrieval system