KEGG   Streptococcus pneumoniae R6 (avirulent serotype 2): spr0813
Entry
spr0813           CDS       T00060                                 

Symbol
ABC-MSD
Name
(GenBank) ABC transporter membrane-spanning permease - unknown substrate
  KO
K19084  bacitracin transport system permease protein
Organism
spr  Streptococcus pneumoniae R6 (avirulent serotype 2)
Pathway
spr02010  ABC transporters
spr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    spr0813 (ABC-MSD)
  09132 Signal transduction
   02020 Two-component system
    spr0813 (ABC-MSD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spr02000]
    spr0813 (ABC-MSD)
Transporters [BR:spr02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Bacitracin transporter
    spr0813 (ABC-MSD)
SSDB
Motif
Pfam: FtsX DUF4179
Other DBs
NCBI-ProteinID: AAK99617
UniProt: Q8DQ76
Position
814380..816368
AA seq 662 aa
MFRLTNKLAVSNLIKNRKLYYPFALAVLLAVTVTYLFYSLTFNPKIAEIRGGTTIQATLG
FGMFVVTLASAIIVLYANSFVMKNRSKELGIYGMLGLEKRHLISMTFKELVVFGILTVGA
GIGIGALFDKLIFAFLLKLMKLKVELVATFQTKVVITVLVVFGLIFLGLMFLNALRIARM
NALQLSREKASGEKKGRFLPLQTILGSISLGIGYYLALTVKDPLTALTTFFIAVLLVIFG
TYLLFNAGITVFLQILKKNKKYYYQPNNLISVSNLIFRMKKNAVGLATIAILSTMVLVTM
SAATSIFNSSESFKKVLNPHDFGVSGQNVEKEDLDKLLSQFASDKGYKIKEKEVFRYTYF
AVANQEGTKLTIFEKGQNRVQPKTVFMVFDQKDYENMTGQKLSLSGNEVGLFAKNEGVKE
QKALTLNDHQFSVKEEFTKDFIVNHVPNQFNILTADYNYLVVPDLQAFLDQFPDSAIYNQ
FYGGMNVNASEAEQLKVAEEYEKYLQKFNAQLNTEGNYVYGSTLADASAQMSALFGGVFF
IGIFLSIIFMVGTVLVIYYKQISEGYEDRERFIILQKVGLDQKQIKQTINKQVLTVFFLP
LLFAFLHLAFAYHMLSLILKVIGVLDTTMMLIVTLSICAIFLIAYVLIFMITSRSYRKIV
QM
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgtttcgattaaccaataagttagcggtatcgaacttgattaaaaaccgcaaactctac
tatccttttgcgctggctgttctcttggcagtcactgtcacctatctcttttactctcta
accttcaatcctaagattgcggaaatccgtggaggaacaaccattcaggctacacttgga
tttggtatgtttgtcgtcacccttgcgtcagccattatcgttctctatgccaatagtttt
gtcatgaagaaccgttccaaggaactaggaatttatggcatgttgggcttggagaagcgt
catcttatcagtatgacctttaaggagttagtggtatttgggattctaactgttggagcg
ggtatcggtattggagccttgtttgacaagttaattttcgctttcctgctcaaactaatg
aaattgaaggttgagctggttgctaccttccagacgaaagttgtcattacagtgcttgtt
gtcttcggtttgattttcctaggcctcatgttcctgaatgcccttcgaatcgcccgtatg
aatgccctccagctctctcgtgagaaagctagtggagagaaaaaaggtcgcttccttcct
ctccaaaccattcttggttccataagtttaggaattggctattatcttgcccttacggta
aaagatcctcttacagccttaacaaccttcttcatagctgttttactggttatctttggg
acttatctcttgtttaatgcagggattaccgttttcctccaaatcttaaagaaaaataag
aaatactattaccaaccaaataacctcatatctgtttctaacttgattttccgtatgaag
aaaaatgcagttggactagccaccatcgctatcttgtcaacaatggttttggtaaccatg
tcagcagcgacaagcattttcaattcctcagaaagctttaaaaaagttctaaatcctcat
gattttggggtttcagggcaaaatgttgaaaaagaagacttggacaaactcttgagccag
tttgcaagtgacaaaggttataagattaaagaaaaagaagtatttcgttacacttacttt
gctgttgcgaatcaagaaggaaccaagttaactatttttgaaaaaggacaaaaccgtgtc
caaccaaaaacagttttcatggtatttgaccaaaaagattatgaaaatatgactggtcaa
aaactgtctctatcaggaaatgaggtcggactctttgcaaagaatgagggagttaaagaa
cagaaagctctaactctaaatgatcatcaattttctgtaaaagaagaatttactaaagat
tttattgtcaaccatgttccaaatcagtttaatattttgactgctgattacaattacctt
gttgtacctgatttacaagcctttttggatcaattcccagattcggctatctataatcag
ttttacggtggtatgaatgtaaatgccagtgaagcagaacaactcaaggtcgctgaggag
tatgaaaaatacttacaaaagtttaatgctcaattaaacactgaaggtaactatgtgtat
ggtagcactctagcagatgctagtgctcagatgagtgccctctttggtggtgtcttcttt
atcggtattttcttatccattatctttatggtcggaaccgttctggtcatctactacaaa
caaatttctgaaggatatgaagaccgtgagcgctttattatcttgcagaaagtcggttta
gatcaaaagcaaatcaagcaaaccatcaacaaacaggttttaactgtattcttccttcct
ttgctctttgccttcctacatctagcctttgcctaccatatgcttagtctgattttaaaa
gtgattggtgtactggatacgactatgatgttgattgtgaccttgtctatctgcgctatc
ttcctcatcgcctatgtgctgattttcatgattacttcaagaagttatcgtaagattgtc
caaatgtaa

DBGET integrated database retrieval system