KEGG   Streptococcus pneumoniae R6 (avirulent serotype 2): spr0894Help
Entry
spr0894           CDS       T00060                                 

Gene name
pfs
Definition
(RefSeq) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
  KO
K01243  adenosylhomocysteine nucleosidase [EC:3.2.2.9]
Organism
spr  Streptococcus pneumoniae R6 (avirulent serotype 2)
Pathway
spr00270  Cysteine and methionine metabolism
spr01100  Metabolic pathways
spr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    spr0894 (pfs)
Enzymes [BR:spr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     spr0894 (pfs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1 TGT
Motif
Other DBs
NCBI-GeneID: 933030
NCBI-ProteinID: NP_358488
UniProt: Q8DQ16
Structure
PDB: 

Position
882643..883335
Genome map
AA seq 230 aa AA seqDB search
MKIGIIAAMPEELAYLVQHLDNTQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVA
ILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFE
SDKTFVAQIQESLSQLDQNWHLGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGAAIAQ
AAHTLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVLLAFLKALD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggaattattgctgctatgccagaagaactggcttatctggtccagcattta
gataatacccaggagcaagttgttttggggaatacctatcatacaggaaccattgcttct
catgaagtcgttcttgtagaaagtggaattggtaaggtcatgtctgctatgagtgtggcg
attttggctgatcatttccaggtggatgcccttattaatacgggttcagctggggcagta
gcagaaggtatcgctgttggggatgtcgtgattgctgacaaattagcctatcatgacgta
gatgtcacagcttttggctatgcttatggacaaatggcgcaacaaccgctttatttcgaa
tcagacaaaacctttgttgctcaaatccaagagagtttatctcaattggaccaaaactgg
catcttggtttgattgctacaggagatagttttgttgcaggaaatgacaagatagaagcg
attaagtcccatttcccagaagttttagccgtggagatggagggggcagctattgctcaa
gcagcgcataccctcaatctcccagtcttagtcatccgagctatgagtgacaatgccaac
catgaagcaaacatcttttttgatgagtttattatcgaagctggacgtcgctctgcccaa
gtcttgttggcctttttgaaggctttagattaa

DBGET integrated database retrieval system