KEGG   Streptococcus pneumoniae R6 (avirulent serotype 2): spr1909Help
Entry
spr1909           CDS       T00060                                 

Gene name
pbp1b
Definition
(RefSeq) penicillin-binding protein 1B
  KO
K03693  penicillin-binding protein 1B
Organism
spr  Streptococcus pneumoniae R6 (avirulent serotype 2)
Pathway
spr00550  Peptidoglycan biosynthesis
spr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:spr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    spr1909 (pbp1b)
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    spr1909 (pbp1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:spr01003]
    spr1909 (pbp1b)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spr01011]
    spr1909 (pbp1b)
Glycosyltransferases [BR:spr01003]
 Polysaccharide
  Bacterial polysaccharide
   spr1909 (pbp1b)
Peptidoglycan biosynthesis and degradation proteins [BR:spr01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   spr1909 (pbp1b)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-GeneID: 934893
NCBI-ProteinID: NP_359500
UniProt: Q7CRA4
Structure
PDB: 

Position
complement(1886036..1888501)
Genome map
AA seq 821 aa AA seqDB search
MQNQLNELKRKMLEFFQQKQKNKKSARPGKKGSSTKKSKTLDKSAIFPAILLSIKALFNL
LFVLGFLGGMLGAGIALGYGVALFDKVRVPQTEELVNQVKDISSISEITYSDGTVIASIE
SDLLRTSISSEQISENLKKAIIATEDEHFKEHKGVVPKAVIRATLGKFVGLGSSSGGSTL
TQQLIKQQVVGDAPTLARKAAEIVDALALERAMNKDEILTTYLNVAPFGRNNKGQNIAGA
RQAAEGIFGVDASQLTVPQAAFLAGLPQSPITYSPYENTGELKSDEDLEIGLRRAKAVLY
SMYRTGALSKDEYSQYKDYDLKQDFLPSGTVTGISRDYLYFTTLAEAQERMYDYLAQRDN
VSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRV
EVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSE
TILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYME
KMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEY
QDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDEN
MWLMLSTPRLTLGGWIGHDDNHSLSRRAGYSNNSNYMAHLVNAIQQASPSIWGNERFALD
PSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQ
NAWSSIVGSLPTPSSSSSSSSSSSDSSNSSTTRPSSSRARR
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcaattaaatgaattaaaacgaaaaatgctggaatttttccagcaaaaacaa
aaaaataaaaaatcagctagacctggcaagaaaggttcaagtaccaaaaaatctaaaacc
ttagataagtcagccattttcccagctattttactgagtataaaagccttatttaactta
ctctttgtactcggttttctaggaggaatgttgggagctgggattgctttggggtacgga
gtggccttatttgacaaggttcgggtgcctcagacagaagaattggtgaatcaggtcaag
gacatctcttctatttcagagattacctattcggacgggacggtgattgcttccatagag
agtgatttgttgcgcacttctatctcatctgagcaaatttcggaaaatctgaagaaggct
atcattgcgacagaagatgaacactttaaagaacataagggtgtagtacccaaggcggtg
attcgtgcgaccttggggaaatttgtaggtttgggttcctctagtgggggttcaaccttg
acccagcaactaattaaacagcaggtggttggggatgcgccgaccttggctcgtaaggcg
gcagagattgtggatgctcttgccttggaacgcgccatgaataaagatgagattttaacg
acctatctcaatgtggctccctttggccgaaataataagggacagaatattgcaggggct
cggcaagcagctgagggaattttcggtgtagatgccagtcagttgactgttcctcaagca
gcatttttagcaggacttccacagagtcccattacttactctccttatgaaaatactggg
gagttgaagagtgatgaagacctagaaattggcttaagacgggctaaggcagttctttac
agtatgtatcgtacaggtgcattaagcaaagacgagtattctcagtacaaggattatgac
cttaaacaggactttttaccatcgggcacggttacaggaatttcacgagactatttatac
tttacaactttggcagaagctcaagaacgtatgtatgactatctagctcagagagacaat
gtctccgctaaggagttgaaaaatgaggcaactcagaagttttatcgagatttggcagcc
aaggaaattgaaaatggtggttataagattactactaccatagatcagaaaattcattct
gccatgcaaagtgcggttgctgattatggctatcttttagacgatggaacaggtcgtgta
gaagtagggaatgtcttgatggacaaccaaacaggtgctattctaggctttgtaggtggt
cgtaattatcaagaaaatcaaaataatcatgcctttgataccaaacgttcgccagcttct
actaccaagcccttgctggcctacggtattgctattgaccagggcttgatgggaagtgaa
acgattctatctaactatccaacaaactttgctaatggcaatccgattatgtatgctaat
agcaagggaacaggaatgatgaccttgggagaagctctgaactactcatggaatatccct
gcttactggacctatcgtatgctccgtgaaaatggtgttgatgtcaagggttatatggaa
aagatgggttacgagattcctgagtacggtattgagagcttgccaatgggtggtggtatt
gaagtcacagttgcccagcataccaatggctatcagaccttagctaataatggagtttat
catcagaagcatgtgatttcaaagattgaagcagcagatggtagagtggtgtatgagtat
caggataaaccggttcaagtctattcaaaagctactgcgacgattatgcagggattgcta
cgagaagttctatcctctcgtgtgacaacaaccttcaagtctaacctgacttctttaaat
cctactctggctaatgcagattggattgggaagactggtacaaccaaccaagacgaaaat
atgtggctcatgctttcgacacctagattaaccctaggtggctggattgggcatgatgat
aatcattcattgtcacgtagagcaggttattctaataactctaattacatggctcatctg
gtaaatgcgattcagcaagcttccccaagcatttgggggaacgagcgctttgctttagat
cctagtgtagtgaaatcggaagtcttgaaatcaacaggtcaaaaaccagggaaggtttct
gttgaaggaaaagaggtagaggtcacaggttcgactgttaccagctattgggctaataag
tcaggagcgccagcgacaagttatcgctttgctattggcggaagtgatgcggattatcag
aatgcttggtctagtattgtggggagtctaccaactccatccagctccagcagttcaagt
agtagttctagcgatagcagtaactcaagtactacacgaccttcttcttcaagggcgaga
cgataa

DBGET integrated database retrieval system