KEGG   Streptococcus pneumoniae R6 (avirulent serotype 2): spr1972Help
Entry
spr1972           CDS       T00060                                 

Gene name
fucA
Definition
(RefSeq) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
spr  Streptococcus pneumoniae R6 (avirulent serotype 2)
Pathway
spr00051  Fructose and mannose metabolism
spr01100  Metabolic pathways
spr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    spr1972 (fucA)
Enzymes [BR:spr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     spr1972 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 932993
NCBI-ProteinID: NP_359563
UniProt: Q8DN17
Structure
PDB: 

Position
complement(1961864..1962517)
Genome map
AA seq 217 aa AA seqDB search
MRRTRMSDVKQELIKYGKKLVETDLTKGTGGNLSVFDREKQLMAITPSGIDFFEIKESDI
VVMDINGNVVEGERLPSSEWYMHLIQYQTRDDIDAIIHAHTTYATVLACLREPLPASHYM
IAVAGKDVRVAEYATYGTKELAVNAAKAMEGRRAVLLANHGILAGAQNLLNAFNIVEEVE
YCAKIYCLAKNFGEPVVLPDEEMELMAEKFKTYGQRK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggacaaggatgtcagatgtaaaacaagaattaattaaatatggtaagaagcta
gtagaaacagatttgacgaaaggaacaggtgggaatctcagcgttttcgatcgtgaaaaa
caattgatggcaattaccccgtcgggtattgatttctttgaaatcaaagaatccgatatt
gtagtgatggatattaatggaaatgttgtagagggagaacgcttgccatctagcgaatgg
tatatgcatttgattcaatatcaaactcgtgatgatatcgatgcaattatccatgctcat
acaacttatgcaacagtattagcttgtctcagagaaccacttccagcgagtcattatatg
attgcagtggcagggaaagatgttcgggtagctgagtatgcaacatatggtacgaaagaa
ttggctgtgaatgcagctaaagcaatggaaggtcgtagagcagttttactagcgaatcat
ggaattttagcaggtgcacaaaatttattgaatgcatttaatattgttgaagaagttgaa
tattgtgcaaaaatttattgtttagctaagaattttggagagccagtagttcttcctgat
gaggagatggaattgatggcagaaaaatttaaaacatacggtcagagaaaatag

DBGET integrated database retrieval system