KEGG   Streptomyces pristinaespiralis: SPRI_0201Help
Entry
SPRI_0201         CDS       T04073                                 

Definition
(GenBank) putative oxygenase
  KO
K14252  6-methylpretetramide 4-monooxygenase / 4-hydroxy-6-methylpretetramide 12a-monooxygenase [EC:1.14.13.232 1.14.13.233]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri00253  Tetracycline biosynthesis
spri01057  Biosynthesis of type II polyketide products
spri01100  Metabolic pathways
spri01110  Biosynthesis of secondary metabolites
spri01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spri00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    SPRI_0201
   00253 Tetracycline biosynthesis
    SPRI_0201
Enzymes [BR:spri01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.232  6-methylpretetramide 4-monooxygenase
     SPRI_0201
    1.14.13.233  4-hydroxy-6-methylpretetramide 12a-monooxygenase
     SPRI_0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 DAO Pyr_redox_2 NAD_binding_8 FAD_binding_2 Lycopene_cycl Thi4 Pyr_redox HI0933_like FAD_oxidored GIDA 3HCDH_N NAD_binding_7 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ALC18507
UniProt: D9UBK8
Position
complement(254916..256697)
Genome map
AA seq 593 aa AA seqDB search
MSDDRRPDVLVAGAGPVGLTAAHELARRGLRVRLVDAATGPARTSRAVAVHPRTLETLDQ
MGTAAPVIEAGRKNRAFTMFASGRRLVRLEADYRSMPTRHPYTVIIEQTRTEAVLRDAVA
RLGVEIEWGVRLTGLEQDTTTVRATLRHADGTEEICETPWLVGCDGGHSTVRKQLGLPLI
GESRDTWLLADAPVRTDLEPDSIYWVHTGKQAMMMVPYARPGHWRLLDTAPRTPDAAGAA
ERIADRLTTGLGHQVHVGDPEWVSVFTFQQRMVPRMHQGRVFVAGDAAHVHSPASGQGMN
TGIQEAYNLAWKLAMVHQGHAGPALLDTYSTERVPIGKQLLGSTRTATFLVQLKNALASL
ALPAVFTVVRAVPPLRRAIQRKVLGGMSGLRIDYATSPLTTGAGPEPVPVAAPVAAPVFV
PRHRHVPAPGERAATATAREPASPGPRAFADELRDVRWTLLVAPGAHTAAGTPVRTATDA
AARHGAWLSVRTVGDTTTPGPRPLPDPDGALRRALGLASGAWALIRPDGYLAAHGGLLTP
RALDEALRPLSLTAPHQPHSTPESLLERASSGRRADRDTVDSTVGAPHKEAQR
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgatgaccgccggcccgacgtcctggtcgccggcgccggcccggtcggcctgacc
gccgcccacgaactggcccgccgcggcctgcgcgtccgcctcgtcgacgccgccaccggc
cccgcccgcaccagccgcgccgtcgccgtccacccgcgcaccctggaaaccctcgaccag
atgggcaccgccgcacccgtcatcgaagccggccgcaagaaccgggcgttcaccatgttc
gcctccggccgccggctggtgcgcctggaggccgactaccgcagcatgcccacccgccac
ccctacaccgtgatcatcgagcagacccgcaccgaggccgtcctgcgcgacgccgtcgcc
cggctcggcgtcgagatcgaatggggcgtacggctcaccggcctcgagcaggacaccacc
accgtacgagccaccctgcggcacgccgacggcaccgaggagatctgcgagacaccctgg
ctggtgggctgcgacggcggccacagcaccgtacgcaaacagctcggcctgcccctgatc
ggcgagagccgcgacacctggctgctggccgacgcacccgtacgcaccgacctcgaaccc
gacagcatctactgggtccacaccggcaaacaggccatgatgatggtgccctacgcccgc
ccgggccactggcggctgctggacaccgccccccggacccccgacgcggccggcgccgcc
gaacgcatcgccgaccgcctcaccaccggcctcggccaccaggtccacgttggcgacccc
gaatgggtctccgtcttcaccttccagcagcgcatggtgccccgcatgcaccaaggccgc
gtcttcgtcgccggcgacgccgcccacgtccacagcccggcctccggacagggcatgaac
accggcatccaggaggcctacaacctcgcctggaaactcgccatggtccaccagggccac
gccggccccgcgctcctggacacctacagcaccgaacgcgtccccatcggcaagcagctc
ctcggctccacccgcaccgccaccttcctcgtccagctcaagaacgccctcgcctccctc
gccctgcccgccgtcttcaccgtcgtacgcgccgtgcccccgctgcgccgcgccatccag
cgcaaggtcctcggcggcatgtccggactgcgcatcgactacgccaccagcccgctgacc
accggcgcaggacccgaacccgtccccgtcgccgcgcccgtcgccgcgcccgtgttcgta
cccaggcaccgccatgtgcccgcccccggcgaacgcgccgccaccgccaccgcccgcgaa
cccgcctcgcccggcccgcgcgccttcgccgacgaactgcgcgacgtgcgctggaccctg
ctcgtcgcccccggcgcccacaccgccgccggcacccccgtccgcaccgccaccgacgcc
gccgcccgccacggcgcctggctgtccgtgcgcaccgtcggcgacaccaccacccccggc
ccacgccccctgcccgaccccgacggcgccctgcgccgcgccctgggcctcgcctccggc
gcctgggcgctcatccgccccgacggctacctcgccgcccacggcggcctgctcaccccc
cgcgccctcgacgaggccctgcgaccgctgtccctgacagcaccgcaccagccccacagc
acacctgagtcccttctcgagcgggcctcgtccggccgtcgagcggaccgggacaccgtc
gacagcaccgtcggcgcaccgcacaaggaggcacaacgatga

DBGET integrated database retrieval system