KEGG   Streptomyces pristinaespiralis: SPRI_0881Help
Entry
SPRI_0881         CDS       T04073                                 

Definition
(GenBank) cellulose 1,4-beta-cellobiosidase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri00500  Starch and sucrose metabolism
spri01100  Metabolic pathways
spri02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPRI_0881
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPRI_0881
Enzymes [BR:spri01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     SPRI_0881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 CBM_2 CARDB
Motif
Other DBs
NCBI-ProteinID: ALC19187
UniProt: A0A0M4DMM2
Position
complement(1043777..1045555)
Genome map
AA seq 592 aa AA seqDB search
MSRDTMSRATAPPLRQKRTALLAACSLLATGAGAVTLMQTPAAAAAIACSVDYQTSDWGS
GFTTTVNVKNTGTTAIENWTLTYAYSGNQKLSSGWNGTWSQSGSTVTVKGADWNRSIAGG
ATVSPGAQFSYSGTNTAPTSFAVNGVTCNGGTTPTDPPTDPPTDPPTDPPTDPPAGDKVD
NPFVGAKMYVNPEWSAKAAAEPGGSRIANTSTSVWLDRIAAIEGVNGGMGLRDHLDEALE
QSGGEPLAINIVVYDLPGRDCSALASNGELGPEELPRYKSEFIDPIAAAVSDPKYAGLRI
TTVIEIDSLPNLITNAGSRPTATPQCDVMKANGNYVKGVGYALAKLGPIPNVYNYIDAGH
HGWLGWDDNFGPSADLFAQAAQAEGSKLEYVHGFITNTANYGILKESYYTIDDAVNGTSV
RQSKWIDWNRYVDELSYAQAFRQRLVQAGFASNIGMLIDTSRNGWGGTARPTGPGPQTSV
DTYVNGGKLDRRIHLGNWCNQAGAGLGERPKAAPEAGIDAYLWVKPPGESDGSSSEIPND
EGKGFDRMCDPTYTGNVRNGNNMSGALGGAPVSGHWFSAQFQELMKNAHPAL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgacaccatgagccgtgccaccgcgccaccactgcgacaaaagcgcaccgcc
ctgctggccgcctgcagcctcctggccaccggcgccggcgccgtcaccctcatgcagacg
cccgccgccgccgcggcgatcgcctgtagcgtcgactatcagaccagcgactggggctcc
ggcttcacgaccacggtcaacgtcaagaacaccggcaccaccgcgatcgagaactggacg
ctgacgtacgcctactcgggcaaccagaagctcagcagcggctggaacggcacctggtcg
cagtccggcagcaccgtcacggtcaagggcgccgactggaaccggtccatcgccggcggc
gcgaccgtctcgccgggcgcccagttctcctacagcggcaccaacaccgcaccgacgtcc
ttcgcggtcaacggcgtgacctgcaacggcggcaccacgcccaccgacccgccgaccgac
ccgccgaccgacccgcccaccgaccctccgaccgaccctccggccggtgacaaggtcgac
aacccgttcgtcggcgcgaagatgtacgtcaaccccgaatggtcggcgaaggcagccgcc
gaaccgggcggcagccgcatcgccaacacctcgacctccgtgtggctcgaccgcatcgcg
gcgatcgagggcgtgaacggcggaatgggcctgcgcgaccacctcgacgaggcgctcgag
cagtccggcggcgagccgctcgccatcaacatcgtcgtctacgacctgcccggtcgcgac
tgctccgccctcgcctccaacggcgagctcggccccgaggaactcccgcgctacaagagc
gagttcatcgacccgatcgcggcggccgtctccgacccgaagtacgcgggtctgcgcatc
accaccgtcatcgagatcgactcgctgcccaacctcatcaccaacgcgggcagccggccc
accgccaccccgcagtgcgacgtgatgaaggcgaacggcaactacgtcaagggcgtcggc
tacgcgctggccaagctcggcccgatccccaacgtctacaactacatcgacgccggacac
cacggctggctcggctgggacgacaacttcggcccgtccgccgacctgttcgcccaggcc
gcccaggccgagggaagcaagctggagtacgtccacggcttcatcaccaacaccgccaac
tacggcatcctcaaggagtcgtactacacgatcgacgacgcggtgaacggcacctccgtc
cgccagtccaagtggatcgactggaaccgctacgtcgatgagctgtcctacgcccaggcc
ttccgccagcgcctggtgcaggccggcttcgcctccaacatcggcatgctgatcgacacc
tcccgcaacggctggggcggcaccgcacggcccaccggaccggggccgcagaccagcgtc
gacacctatgtgaacggcggcaagctcgaccgccggatccacctcggcaactggtgcaac
caggcgggcgcgggtctcggcgagcggccgaaggcggctcccgaggcgggcatcgacgcc
tacctgtgggtcaagcccccgggtgagtccgacggctccagctcggagatcccgaacgac
gagggcaagggcttcgaccggatgtgcgacccgacctacacgggcaacgtacgcaacggg
aacaacatgtccggcgcgctgggcggtgccccggtctccggtcactggttctccgcgcag
ttccaggagctcatgaagaacgcccacccggcgctctag

DBGET integrated database retrieval system