KEGG   Streptomyces pristinaespiralis: SPRI_3683Help
Entry
SPRI_3683         CDS       T04073                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri00450  Selenocompound metabolism
spri00970  Aminoacyl-tRNA biosynthesis
spri01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spri00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SPRI_3683
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPRI_3683
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spri01007]
    SPRI_3683
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spri03016]
    SPRI_3683
Enzymes [BR:spri01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SPRI_3683
Amino acid related enzymes [BR:spri01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SPRI_3683
Transfer RNA biogenesis [BR:spri03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SPRI_3683
 Prokaryotic type
   Other AARSs
    SPRI_3683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ALC21989
UniProt: A0A0M3QIS3
Position
4294137..4295714
Genome map
AA seq 525 aa AA seqDB search
MKSYYVSTPIYYVNDAPHLGHAYTTVAGDVLTRWHRQRGEKVWYLTGTDEHGQKIMRTAE
ANGVTPQEWCDKLVEEAWKPLWEHLNIANDDFIRTTEKRHTDRVQEFVQDLYDKGEIYKG
GYEGPYCVGCEEYKLPGDLIEAEDGTKLCPIHKKPVEILKEENYFFKLSEYGPKLLDFYA
ANPDFIQPESARNEVVNFVKQGLQDLSISRSTFDWGVPVPWDEKHVIYVWIDALLNYATA
VGYGSNQAKFDETFPANVHLVGKDILRFHAIIWPAMLMAQGLPVPGKVAANGWLMVGGEK
MSKSNLTGIKPQDLTSHFGVDAYRWYFLRAIAFGQDGSFSWEDFTARYTSELANDYGNLA
SRVAAMVGKYFEGALPAATAAGEAEQAVQDGLAKAVAEADRKIGEELDFQSGILSVFEFV
KQVNGYITEQEPWKVAKDDSPEGRARLATILYTAAESLRAVAVLLNPVMPETSQKLWDSL
GADAALGALADQKVQEAGEWGKLPAGATVTKGAVLFPRLEEPKKA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcctactacgtgtcgacccccatttactacgtcaacgacgctcctcacctgggc
cacgcctatacgaccgtcgcaggcgacgtgctcacacgctggcaccgtcagcgtggcgag
aaggtgtggtacctcaccggcacggacgagcacggtcagaagatcatgcgcaccgcggag
gcgaacggcgtcacgccccaggagtggtgcgacaagctcgtcgaggaggcctggaagccc
ctctgggagcacctgaacatcgcgaacgacgacttcatccgcaccacggagaagcggcac
acggaccgtgtgcaggagttcgtgcaggacctgtacgacaagggcgagatctacaagggc
gggtacgaaggcccgtactgcgtgggctgtgaggagtacaagctccccggcgacctcatc
gaggccgaggacggcaccaagctgtgcccgatccacaagaagccggtggagatcctcaag
gaggagaactacttcttcaagctcagcgagtacggcccgaagctgctggacttctacgcg
gcgaacccggacttcatccagcccgagtcggcccgcaacgaggtcgtgaacttcgtcaag
cagggccttcaggacctgtccatctcgcgctcgacgttcgactggggcgtcccggtcccg
tgggacgagaagcacgtcatctacgtgtggatcgacgcgctcctcaactacgccaccgcg
gtcggctacggctcgaaccaggcgaagttcgacgagaccttcccggcgaacgtccacctg
gtgggcaaggacatcctgcgcttccacgcgatcatctggcccgcgatgctgatggcgcag
ggcctgccggtgcccggcaaggtcgcggccaacggctggctgatggtcggcggcgagaag
atgtcgaagtccaacctgaccggcatcaagccgcaggacctcacctcgcacttcggtgtg
gacgcgtaccgctggtacttcctgcgcgccatcgcgttcggccaggacggttcgttctcc
tgggaggacttcaccgcccggtacacctccgagctcgccaacgactacggcaacctcgcc
tcccgtgtggcggccatggtcggcaagtacttcgagggcgcgctgcccgctgccacggcc
gcgggtgaggcggagcaggcggtccaggacggcctggcgaaggcggtcgcggaggccgac
cggaagatcggcgaggagctggacttccagagcggcatcctgagcgtcttcgagttcgtg
aagcaggtcaacggctacatcacggagcaggagccgtggaaggtcgccaaggacgactcc
ccggagggccgggcccgtctggcgaccatcctgtacacggcggcggagtccctgcgcgcg
gtcgcggtcctgctcaacccggtcatgcccgagacgtcccagaagctgtgggactccctg
ggcgcagacgccgcactgggcgcgctcgcggaccagaaggtccaggaggccggcgagtgg
ggcaagctgcccgccggagcgacggtgacgaagggcgcggtgctgttcccgcgcctggag
gagccgaagaaggcctga

DBGET integrated database retrieval system