KEGG   Streptomyces pristinaespiralis: SPRI_6091Help
Entry
SPRI_6091         CDS       T04073                                 

Definition
(GenBank) DNA/pantothenate metabolism flavoprotein
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri00770  Pantothenate and CoA biosynthesis
spri01100  Metabolic pathways
Module
spri_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:spri00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SPRI_6091
Enzymes [BR:spri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     SPRI_6091
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     SPRI_6091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ALC24397
UniProt: A0A0M4DKS7
Position
7054209..7055441
Genome map
AA seq 410 aa AA seqDB search
MDAVDGSVDAAVRPKVVLGVSGGIAAYKACELLRRLTESGHEVRVVPTASALQFVGAPTW
SALSGQPVHTDVWSDVHEVPHVRIGQHADLVVVAPATADMLAKAAHGLADDLLTNTLLTA
RCPVVFAPAMHTEMWEHPATQENVATLRRRGAVVIEPAVGRLTGVDTGKGRLPDPGEIFE
ICRRVLARGVEAPDLAGRHVVVSAGGTREPLDPVRYLGNRSSGKQGYALARTAAARGARV
TLVEANTGMPDPAGVDVVHVGTAVQLREAVLKAAADADAVVMAAAVADFRPAAYAEGKIK
KKDGVEAPVVTLVRNPDILAEISADRARPGQVIVGFAAETDDVLANGRDKLRRKGCDLLV
VNEVGEHRTFGAEVNEAVVLAADGGETPVPHGPKEALADTVWDLVVPRLA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtggacgcagtggacggttcggtggacgcggcggtcaggccgaaggtggtgctgggcgtg
agcggcggcatcgccgcctacaaggcctgcgagctgctgcgcaggctcacggagtcgggc
cacgaggtccgggtcgtgccgacggcgtcggcgctgcagttcgtcggcgcgccgacctgg
tccgcgctctccgggcagcccgtccacaccgacgtctggtcggacgtccacgaggtcccg
cacgtacgcatcggacagcacgccgacctcgtcgtcgtggcgcccgccaccgcggacatg
ctcgccaaggccgcccacgggctcgccgacgacctcctcacgaacaccctgctcaccgcc
cgctgtccggtcgtcttcgccccggcgatgcacacggagatgtgggagcaccccgccacc
caggagaacgtcgccaccctgcgccgccgcggcgccgtcgtgatcgagcccgccgtgggc
cggctcaccggcgtcgacaccggaaaggggcggctgcccgacccgggcgagatcttcgag
atctgccgccgcgtcctcgcccgcggggtcgaggcgcccgacctggccggccgtcatgtc
gtcgtcagcgcgggcggcacccgcgaacccctcgacccggtgcgctacctcggcaaccgc
tcctccggaaagcagggctacgcgctcgcccgcaccgcggccgcccgcggggcccgcgtc
accctcgtcgaggcgaacaccgggatgccggacccggcaggcgtcgacgtcgtccacgtc
ggcacggcggtgcagctgcgggaggccgtgctcaaggccgccgcggacgccgacgccgtc
gtcatggcggccgccgtcgcggacttccgccccgccgcctacgccgaggggaagatcaag
aagaaggacggcgtggaggccccggtggtgacgctggtgcgcaaccccgacatcctcgcc
gagatctccgcggaccgggcccgccccggacaggtgatcgtcggcttcgccgcggagacc
gacgacgtcctcgccaacggccgcgacaagctgcgccgcaagggctgcgacctgctcgtc
gtcaacgaggtgggggagcacaggaccttcggcgcggaggtcaacgaggccgtcgtgctc
gccgcggacggcggtgagacaccggttccgcacggacccaaggaagccctcgccgacacg
gtctgggacctcgtcgtgccccggctcgcctga

DBGET integrated database retrieval system