KEGG   Spiroplasma sp. NBRC 100390: S100390_v1c02100Help
Entry
S100390_v1c02100  CDS       T05859                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sprn  Spiroplasma sp. NBRC 100390
Pathway
sprn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sprn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    S100390_v1c02100 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sprn03011]
    S100390_v1c02100 (rplV)
Ribosome [BR:sprn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    S100390_v1c02100 (rplV)
  Bacteria
    S100390_v1c02100 (rplV)
  Archaea
    S100390_v1c02100 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: APE13023
UniProt: A0A1J0TZT9
Position
237197..237535
Genome map
AA seq 112 aa AA seqDB search
MDVRANLRSIRISPRKVRLVADLIRNKKVGDAIVILNNTNKKSSVPVQKLVKSAVANAVN
NNGLDADRLFIKEIFVNEGPTLKRFRPRAHGRAYEILKRTSHITVTVSDGQQ
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaagagcaaacttaagaagtattcgaatatcgccacgaaaagttagattggtt
gccgatttaattcgtaacaaaaaagtgggagacgcaatagttattcttaacaacacaaac
aaaaaatcatcagtaccagttcaaaaattagtaaagtcagcagtagcaaatgctgttaac
aataatgggttggatgctgatcgcttatttattaaagaaatcttcgttaacgaaggacca
acattaaaacgattccgtcctcgtgcccacggacgagcatatgaaattttaaagagaaca
agtcacatcacagttactgttagtgatgggcagcaataa

DBGET integrated database retrieval system