KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0325Help
Entry
SPs0325           CDS       T00119                                 

Definition
(GenBank) putative Glu-tRNA Gln amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
sps00970  Aminoacyl-tRNA biosynthesis
sps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sps00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPs0325
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sps03029]
    SPs0325
Enzymes [BR:sps01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SPs0325
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SPs0325
Mitochondrial biogenesis [BR:sps03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPs0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln DUF2420
Motif
Other DBs
NCBI-ProteinID: BAC63420
UniProt: P0DB29
Position
364644..364958
Genome map
AA seq 104 aa AA seqDB search
MGEIMKISEEEVRHVAKLSKLSFSESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMA
DKKNVMRQDVAEEGTDRALLFKNVPEKENHFIKVPAILDDGGDA
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaatcatgaaaatttctgaagaagaagttcgccatgtcgcgaagctatcaaaa
ttatcattttcagaaagtgagacaacaacctttgcaacgaccctatctaaaatcgttgac
atggttgaattgctgaacgaagttgataccgaaggtgttgccattacaacaaccatggca
gataagaaaaatgtgatgcgtcaagatgtcgctgaagaaggaacagaccgtgccttgctc
tttaaaaatgttcctgaaaaagaaaatcactttatcaaggtacctgctattttggatgac
ggaggagatgcctaa

DBGET integrated database retrieval system