KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0326Help
Entry
SPs0326           CDS       T00119                                 

Definition
(GenBank) putative glutamyl-tRNA Gln amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
sps00970  Aminoacyl-tRNA biosynthesis
sps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sps00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPs0326
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sps03029]
    SPs0326
Enzymes [BR:sps01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SPs0326
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SPs0326
Mitochondrial biogenesis [BR:sps03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPs0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAC63421
UniProt: P0CZ61
Position
364958..366424
Genome map
AA seq 488 aa AA seqDB search
MSFNHKTIEELHDLLVAKEISATELTQKTLEDIKSREEAVGSFITVSEEAALKQAAAIDA
KGIDSDNLMSGIPLAVKDNISTKGILTTAASKMLYNYEPIFDATSVANAYAKDMIVIGKT
NMDEFAMGGSTETSYFKKTKNAWDHTKVPGGSSGGSATAVASGQVRLSLGSDTGGSIRQP
AAFNGVVGLKPTYGTVSRYGLIAFGSSLDQIGPFAPTVKENAQLLNVVASSDVKDATSAP
VRIADYTSKIGRDIKGMKIALPKEYLGEGIDPEIKETVLAAAKQFEALGATVEEVSLPHS
KYGVAVYYIIASSEASSNLQRFDGIRYGFRADDAKNLDEIYVNTRSQGFGDEVKRRIMLG
TFSLSSGYYDAYFKKAGQVRTLIIEDFDKVFADYDLILGPTTPTVAFGLDTLNHDPVAMY
LADLLTIPVNLAGLPGISIPAGFVDGLPVGLQLIGPKYTEETIYQAAAAFEAVTDYHKQQ
PIIFGGDK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttaatcataaaaccattgaagagttgcatgacctccttgtagctaaggagatt
tccgcaaccgaattgactcaaaaaacacttgaagacatcaagtctcgtgaggaggctgtc
gggtcgtttatcactgtttcagaagaagctgctcttaaacaagctgcggcaattgatgcc
aaaggtattgattctgacaacctcatgtcaggtattccgttagctgttaaggataatatc
tcaaccaagggcatcctaaccacagccgcttcaaaaatgttgtataactacgagccgatt
tttgatgccacatcagtagcaaatgcctacgctaaagacatgattgttattggaaaaacc
aacatggacgaatttgccatgggtggttcaacagaaacctcttatttcaagaaaacgaaa
aatgcttgggaccacacaaaagtacctggtggctcatcaggtggttcggcaacagcagtc
gcttcaggacaagtccgtttatctcttggttcagacactggtggttctattcggcagcca
gctgcatttaatggtgttgtcggtttgaaaccaacctatggcactgtttctcgctatggt
ctcattgcttttggaagttcacttgatcagattggaccttttgctccgacagttaaagaa
aacgcccaattattaaatgtggttgcaagtagcgatgtcaaggatgccacttcagcgcct
gtccgcattgcagactacacatctaagattggtcgtgacattaaaggcatgaagattgcc
cttcctaaagagtatcttggcgaagggattgatcctgagattaaggaaacggttcttgcg
gcagctaaacaatttgaagccttaggagctactgttgaggaagttagtcttccacatagc
aaatatggtgtggctgtctattacattattgcttcgtcagaagcgtcctcaaacttacaa
cgttttgatggcattcgctatggtttccgtgctgacgatgctaaaaacttggatgaaatc
tatgttaacactcgtagccaaggctttggtgatgaggttaaacgtcgtatcatgcttggg
acctttagtttgtcatcaggttattatgacgcttatttcaaaaaggccggtcaagtgcgt
accttgattattgaagattttgacaaggtctttgcggattatgatcttattttaggccca
acaacaccgacggttgcttttggcttagacacactcaaccacgatcctgttgccatgtat
ttggccgacttattgaccattccagttaacttggctggtctgccaggaatttccattcca
gcaggattcgtcgatggcttgccagtagggcttcaattaattggtccgaaatacactgaa
gaaaccatctatcaagcagcagcagcctttgaagcggtgacagattatcacaagcaacaa
ccgattatttttggaggtgacaagtaa

DBGET integrated database retrieval system