KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0327Help
Entry
SPs0327           CDS       T00119                                 

Definition
(GenBank) putative Glu-tRNA Gln amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
sps00970  Aminoacyl-tRNA biosynthesis
sps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sps00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPs0327
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sps03029]
    SPs0327
Enzymes [BR:sps01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SPs0327
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SPs0327
Mitochondrial biogenesis [BR:sps03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPs0327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Chlam_vir
Motif
Other DBs
NCBI-ProteinID: BAC63422
UniProt: P0DB27
Position
366424..367863
Genome map
AA seq 479 aa AA seqDB search
MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVMNKGVIDAGI
KAALALNMDIHKEMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEIKLEDGSTKKIRIE
RAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEIIQYTG
ISDVKMEEGSMRVDANISLRPYGQEQFGTKTELKNLNSFSNVRKGLEFEVERQAKLLRSG
GAIRQETRRYDEANKGTILMRVKEGAADYRYFPEPDLPLYEIDDAWIDEMRAQLPQFPAQ
RRAKYEEELGLSAYDASQLTATKALSDFFETAVSLGGDAKQVSNWLQGEVAQFLNAEGKT
IEEIALTPENLVEMIAIIADGTISSKMAKKVFVHLAKNGGSARAYVEKAGLVQISDPAVL
VPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATKGQANPQVAQQLLAQELQKLRD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaaccattattgggcttgaagtccatgtggaattaaataccaattccaaa
attttctcaccttcgtcagctcactttggtgaggatccaaatgccaacacgaatgtgatt
gattggtcttttccaggggtcttaccagtcatgaacaaaggcgttattgatgcgggcata
aaagctgcgcttgccctcaatatggacatccataaagagatgcatttcgaccgcaaaaat
tatttctacccagataatcctaaagcttatcaaatttcacagtttgacgagccgattggc
tacaacggatggattgagattaaattggaagacggttcaaccaagaaaattcgtattgaa
cgcgcacacttggaagaagatgctggtaaaaacactcacggcacagatggttattcttat
gtggaccttaaccgccaaggagttcctttgattgagattgtgtcagaagccgacatgcgt
tctcctgaagaagcctatgcttatttgacagctctgaaagaaatcatccagtacacaggc
atttctgacgtcaagatggaagaaggctctatgcgggtggatgccaatatttcccttcgt
ccttacgggcaagaacaatttggaacaaagactgaattgaaaaacttgaactccttctca
aatgtccgtaaagggcttgaatttgaggtggaacgtcaagccaaactcttgcgttcaggt
ggggcgatacgccaagaaacgcgccgctatgacgaagcgaataaggggactattttgatg
cgggtcaaagaaggggcagcggactatcgttatttcccagaaccagacctacccttgtat
gagattgatgatgcttggattgacgagatgcgtgctcaattacctcaattcccagctcaa
cgtcgtgctaaatacgaagaggaacttggtctctcagcttatgatgctagccagctaaca
gctaccaaagccttgtcagatttctttgaaactgcagtaagtcttggtggcgatgccaag
caagtctctaactggttgcaaggagaagttgcccaattcttaaacgcagaaggcaaaacc
attgaagaaatcgctctgacaccagaaaatttggtggagatgattgctatcattgctgat
ggtacaatctcttctaaaatggctaagaaggtttttgtgcatttggctaaaaacggtggc
tcagcacgtgcttatgtggaaaaagcaggacttgttcagatttctgatcccgctgttttg
gtaccaattattcaccaagtctttgctgataatgaagctgcagtggctgatttcaaatca
ggcaaacgtaatgctgataaggctttcacaggcttcttgatgaaggcaaccaaaggtcaa
gctaatccacaagtcgctcaacaattattggcacaagaattgcaaaaattgcgagattga

DBGET integrated database retrieval system