KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0487Help
Entry
SPs0487           CDS       T00119                                 

Definition
(GenBank) putative guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
sps00230  Purine metabolism
sps01100  Metabolic pathways
Module
sps_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SPs0487
Enzymes [BR:sps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SPs0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 DUF1236 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: BAC63582
UniProt: P0DB95
Position
519299..519934
Genome map
AA seq 211 aa AA seqDB search
MSERGLLIVFSGPSGVGKGTVRQEIFSTPDHKFEYSVSMTTRPQRPGEVDGVDYFFRTRE
EFEELIKTGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKSKVPDGVF
VFLTPPDLDELEDRLVGRGTDSQEVIAQRIERAKEEIALMREYDYAVVNDEVALAAERVK
RIIETEHFRVERVIGRYDKMIKITKNPFKAK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgcggtttgttaatcgtcttttctggcccttcaggtgtcggaaaaggaacg
gtaagacaagaaattttttcaacgccagatcataaatttgaatattcggtttcaatgacg
actcgtccgcaaagaccgggcgaggttgatggggttgattatttcttccgcacacgagaa
gaatttgaggaactcattaaaactggtcaaatgctagagtatgctgaatatgttggtaat
tactatggcacccctttaacttatgttaatgagactcttgataagggaattgatgtcttt
ttagaaattgaagttcaaggagctcttcaggttaagtcaaaagtaccagatggtgttttt
gtttttttaacaccaccagatttagatgaattagaagaccgcctggttggtcgtggtaca
gatagtcaagaagtcatagctcaacgtattgaaagagcaaaagaagaaattgcccttatg
cgcgaatacgattatgcagttgttaatgatgaagttgccttggcagctgagcgggttaag
cgtatcattgagacagaacactttcgtgtggagcgcgtgattggtcgttatgataaaatg
attaaaataacaaaaaatccctttaaagctaaatag

DBGET integrated database retrieval system