KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs1036Help
Entry
SPs1036           CDS       T00119                                 

Definition
(GenBank) putative oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
sps00620  Pyruvate metabolism
sps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPs1036
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sps02000]
    SPs1036
Enzymes [BR:sps01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     SPs1036
Transporters [BR:sps02000]
 Other transporters
  Primary active transporters [TC:3]
   SPs1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA His_biosynth ADH_zinc_N Sulfotransfer_4
Motif
Other DBs
NCBI-ProteinID: BAC64131
Position
1019204..1020616
Genome map
AA seq 470 aa AA seqDB search
MMRRTIMTKIRITETVLRDGQQSQIATRMTTKEMIPILETLDNAGYHALEMWGGATFDSC
LRFLNEDPWERLRAIRKAVKKTKLQMLLRGQNLLGYRNYADDVVRSFVQKSIENGIDIVR
IFDALNDPRNLQTAVSATKKFGGHAQVAISYTTSPVHTIDYFVELAKAYQAIGADSICIK
DMAGVLTPEIGYQLVKRIKENTTIPLEVHTHATSGISEMTYLKVAEAGADIIDTAISSFS
GGTSQPATESMAIALTDLGFDTGLDMQEVAKVAEYFNTIRDHYRETGILNPKVKDTEPKT
LIYQVPGGMLSNLLSQLTEQGLADKYEEVLAEVPKVRADLGYPPLVTPLSQMVGTQALMN
IISGERYKVVPNEIKDYVRGLYGQSPAPLAEGIKEKIIGDEAVIACRPADLIEPQMIYLR
DEIAPYARSEEDVLSYASFPQQARDFLGRREDPFYDVPVQEVTVQLDIQD
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaggagaacaattatgacgaaaatccgtataacggaaacagttttacgtgatggt
caacaaagtcagattgccacacgtatgacaaccaaggaaatgattcctattctcgaaacg
ctagacaatgctggttatcatgcccttgaaatgtggggaggagcaacctttgattcctgc
ctacgctttttaaatgaagacccttgggaacggctaagagccatccgtaaagcagtgaaa
aagactaaacttcagatgctcttacgcggacaaaaccttcttggatatcgcaattatgct
gacgatgtggtcagatccttcgttcaaaaatccattgaaaacgggattgatattgtccgt
atcttcgatgctttaaatgaccctcgcaacttgcaaacagctgtttcagcgactaaaaaa
tttggagggcatgctcaagttgccatttcttacacgacaagtccggtacataccattgat
tactttgttgaattggcgaaagcttaccaagctatcggagctgactccatttgtatcaaa
gacatggctggtgtcttaactcctgaaataggttaccaattggtcaaacgtatcaaggag
aatacaactatccctcttgaagttcatacccatgctaccagtggtatttcagaaatgact
tacttaaaagtggcagaagcaggagctgatattattgatacagcgatttcctctttttca
gggggaaccagtcagcctgccacagaatcaatggcgattgccttgacggatttaggcttt
gacacaggcttggatatgcaagaggtagccaaagttgcagaatatttcaataccattcgt
gaccactaccgagagacagggattttaaatcctaaagtcaaagatactgagccaaaaaca
ttgatttaccaagttccaggtggcatgctatcaaacctattgagccaattaaccgagcaa
ggcctagctgataaatacgaagaagtcttagcagaagtacctaaagtaagggccgatctt
ggatatccaccacttgtaacgccattatcacaaatggttggcacacaggccttgatgaat
atcatctcaggggaacgctacaaggtagttccaaatgaaatcaaagactatgttcgaggg
ctatacggtcaatcaccagcgccactagcagaaggtatcaaagagaaaatcattggtgac
gaagcagtcattgcttgcagaccagccgacctaatcgagcctcaaatgatttatctacgt
gacgagattgctccatacgctcgttcagaagaagacgtgttaagctatgcgagtttccca
cagcaagccagagatttcttgggacgccgtgaagatcctttctatgatgttccggttcaa
gaagttactgtacaactggacattcaagactaa

DBGET integrated database retrieval system