KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs1254Help
Entry
SPs1254           CDS       T00119                                 

Definition
(GenBank) putative 3-hydroxy-3-methylglutaryl-coenzyme A
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
sps00900  Terpenoid backbone biosynthesis
sps01110  Biosynthesis of secondary metabolites
sps01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sps00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPs1254
Enzymes [BR:sps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SPs1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red CAMSAP_CH
Motif
Other DBs
NCBI-ProteinID: BAC64349
Position
1236571..1237848
Genome map
AA seq 425 aa AA seqDB search
MTKTNLNWSGFSKKTFEERLQLIEKFKLLNAENLNQLKTDVLLPIQTANQMTENVLGRLA
LPFSIAPDFLVNGSTYQMPFVTEEPSVVAAASFAAKLIKRSGGFKAQTLNRQMIGQIVLY
DIDQIDNAKAAILHKTKKLIALANKAYPSIVKRGGGARTIHLEEKGEFLIFYLTVDTQEA
MGANMVNTMMEALVPDLTRLSKGHCLMAILSNYATESLVTTSCEIPVRLLDRDKTKSLQL
AQKIELASRLAQVDPYRATTHNKGIFNGIDAVVIATGNDWRAIEAGAHAYASRNGSYQGL
SQWHFDQDKQVLLGQMTLPMPIASKGGSIGLNPTVSIAHDLLNQPDAKTLAQLIASVGLA
QNFAALKALTSSGIQAGHMKLHAKSLALLAGATQDEIAPLVNALLADKPINLEKAHFYLS
QLRQS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaactaatcttaactggagcggtttttcaaagaaaacattcgaagaacgcctc
caacttatcgaaaaatttaaactacttaatgctgaaaacttaaatcaactcaaaacagac
gttcttttgcctatccaaacagctaatcaaatgactgaaaatgtcttaggacgattggct
ttgccctttagcatagctcctgattttcttgtcaacggttcaacttatcagatgcctttt
gtcacggaagaaccttctgttgttgctgcagcatctttcgcagcaaaactaatcaaacgc
tcaggtggttttaaagctcaaaccctaaaccgacaaatgattggtcaaattgttctttac
gatatcgaccaaatagataacgctaaagccgccatccttcataaaacaaaaaagctaatt
gcattggcaaataaagcttatccttccattgttaaaagaggtggaggcgctagaaccatt
catttggaagaaaaaggagaatttttgattttctatctgactgttgatacccaagaagct
atgggagcaaatatggtcaatactatgatggaagctcttgttcctgatttaacaagactg
tctaaggggcattgtctaatggcgattttatctaattacgcaacagagtcgcttgttact
actagttgtgagattcccgtgcgccttttagatcgcgataaaacaaaatccctacagtta
gctcaaaaaatagagctagccagccgactagctcaagtagatccttaccgggctactact
cataataaaggtatttttaatggtattgatgcagtggtaatagccacaggaaatgactgg
cgtgctattgaagcaggggcccatgcttatgcctcaagaaatggtagctatcaaggactt
agtcagtggcattttgaccaagataaacaagttctgcttggccaaatgaccctccctatg
cctattgctagtaaggggggatctatcgggcttaaccctactgtttctatcgcacatgat
cttcttaatcaacctgatgccaaaacattagcccaattgattgcatctgtggggttagct
caaaactttgctgcactaaaagctctgacctcatctggcatccaagctggtcacatgaaa
ctacatgcgaaatcattagctcttttggcgggggcaacccaagacgaaattgctccttta
gttaatgctttactagctgataaaccaataaatctagaaaaagcacatttttacttatcc
cagctaagacagtcttag

DBGET integrated database retrieval system