KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs1484Help
Entry
SPs1484           CDS       T00119                                 

Definition
(GenBank) putative acetyl-CoA c-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
sps00071  Fatty acid degradation
sps00072  Synthesis and degradation of ketone bodies
sps00280  Valine, leucine and isoleucine degradation
sps00310  Lysine degradation
sps00362  Benzoate degradation
sps00380  Tryptophan metabolism
sps00620  Pyruvate metabolism
sps00630  Glyoxylate and dicarboxylate metabolism
sps00640  Propanoate metabolism
sps00650  Butanoate metabolism
sps00900  Terpenoid backbone biosynthesis
sps01100  Metabolic pathways
sps01110  Biosynthesis of secondary metabolites
sps01120  Microbial metabolism in diverse environments
sps01130  Biosynthesis of antibiotics
sps01200  Carbon metabolism
sps01212  Fatty acid metabolism
sps02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPs1484
   00630 Glyoxylate and dicarboxylate metabolism
    SPs1484
   00640 Propanoate metabolism
    SPs1484
   00650 Butanoate metabolism
    SPs1484
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPs1484
   00072 Synthesis and degradation of ketone bodies
    SPs1484
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPs1484
   00310 Lysine degradation
    SPs1484
   00380 Tryptophan metabolism
    SPs1484
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPs1484
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPs1484
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPs1484
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sps04147]
    SPs1484
Enzymes [BR:sps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPs1484
Exosome [BR:sps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPs1484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAC64579
Position
complement(1485771..1486919)
Genome map
AA seq 382 aa AA seqDB search
MTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPAPIDQVICGNTVGTGGNI
GRLMTLYSHLGESVSALTVDMQCASAGAALSVGYAKIKAGMASNLLVGGIESSSLQPESV
YASADWRQGAYKVAQFSPDSISPFAMIEGAERVAREHGFTKEYLNHWTLRSHQKASYCQE
QALLADLILDLPGASDQGIRPRLSSKVLSKVPPILGEDHVISAANACLTHDAAAFLQLSS
QPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLEKHGLGMADMTAIEWNEAFAVIDGLFET
HYPDLLDRYNIFGGALAYGHPYGASAAIIILHLMRALEIKNGRYGIAAIAAAGGQGFAVL
LKYHKEFSHADKARILGKAMPK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtttatattgctgcaggccttagaacccctatcggtttagtagggaaacaa
tttgctaaagagcagccagaaatccttggagcaaagctcatcaatgctttacaaaataag
tatccagctcctattgaccaagtgatttgtggcaataccgtcggaacgggtggtaatatt
gggcgcttgatgaccctgtattctcatttaggagaatctgtctctgctttgacggttgat
atgcagtgtgcatcagctggtgcagctctttccgtgggttatgctaaaatcaaggcaggt
atggcaagcaaccttttagtgggagggattgaaagcagctccttacaacctgaatcggta
tatgcttcagctgattggcgccaaggagcctacaaggtagctcagttttctccagatagt
atcagcccttttgcgatgattgagggggcagaacgagtggcaagagagcatggctttaca
aaggagtatttgaatcactggacattgagaagtcatcaaaaggctagttattgccaggag
caagccctgttagctgatcttattctagacctgccaggagccagtgatcaaggtattcga
ccgcgcttgtcaagtaaggtgttgtcaaaggtaccccctatcttaggagaagatcacgtg
attagtgcagccaatgcctgcctaacccatgatgctgctgcctttttacagctaagtagt
cagccttcagcttttaaactgattgatgtggtagaagtagcaggagacccacagcgtagc
cctttaatggtgattaaggctagtcaagtccttttggaaaaacatggtctagggatggca
gatatgacagcgattgaatggaacgaagcctttgccgttattgatggtctatttgaaacc
cattatccagatttattggaccgctataatatatttggtggtgcattagcttatggtcat
ccctatggtgcctcagcagccattataatattgcacttaatgagggctttagagattaaa
aatggacgctatggaatagctgctatagcagcagctggtggccaagggtttgctgtttta
ctaaaatatcataaggagtttagtcatgctgacaaagctagaatattgggcaaagcaatg
cccaaataa

DBGET integrated database retrieval system