KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs1557Help
Entry
SPs1557           CDS       T00119                                 

Definition
(GenBank) putative methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
sps00450  Selenocompound metabolism
sps00970  Aminoacyl-tRNA biosynthesis
sps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sps00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SPs1557
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPs1557
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sps01007]
    SPs1557
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sps03016]
    SPs1557
Enzymes [BR:sps01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SPs1557
Amino acid related enzymes [BR:sps01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SPs1557
Transfer RNA biogenesis [BR:sps03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SPs1557
 Prokaryotic type
   Other AARSs
    SPs1557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 Imm21
Motif
Other DBs
NCBI-ProteinID: BAC64652
UniProt: P0DG49
Position
complement(1553474..1555474)
Genome map
AA seq 666 aa AA seqDB search
MMKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTK
AKEAGITPQTYVDNMAKDVKALWQLLDISYDKFIRTTDDYHEEVVAAVFEKLLAQDDIYL
GEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEWVSEESYFLRLSKYADR
LVAFFKERPDFIQPDGRMNEMVKNFIEPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDA
LLNYATALGYGQANHANFDKFWNGTVFHMVGKDILRFHSIYWPILLMMLDLPMPDRLIAH
GWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYE
LANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQVIDAQLADYHKHMEAVDYPR
ALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRVVAHVIQPFMMETS
AAIMAQLGLAPVSDLSTLALADFPANTKVVAKGTPIFPRLDMEAEIDYIKAQMGDSSAIS
QEKEWVPEEVALKSEKDVITFETFDAVEIRVAEVKEVSKVEGSEKLLRFRVDAGDGQDRQ
ILSGIAKCYPNEQELVGKKLQIVANLKPRKMMKKYISQGMILSAEHGDQLTVLTVDSSVP
NGSIIG
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaaccattttacattacgacacccatttattacccatctgggaaattacac
attggttctgcctatacaactattgcttgtgatgtcttggcacgctacaagcgcctgatg
ggccatgaggtcttttacctcacaggactagatgagcacggacaaaagattcaaaccaag
gcaaaagaagctggtattacacctcaaacctacgttgataacatggcaaaggatgtcaaa
gccctttggcaattgctagatatttcttatgataaatttatccggacaactgacgattac
cacgaagaagtcgttgctgctgtttttgaaaaattgctggcgcaagacgacatttacctt
ggcgaatactctggttggtattctgtctctgatgaggaatttttcactgaaagccaatta
aaagaagtctttagagatgaagacggtcaggttattggagggattgccccatcaggtcat
gaggtcgagtgggtctctgaagaatcctatttcctacgccttagcaaatacgctgatcgt
cttgtggccttctttaaagagcgacctgactttatccaaccagacggtcgtatgaatgaa
atggtgaaaaactttatcgagccaggcctagaagatttggctgttagccgtactaccttt
acatggggtgtacctgttccatcagacccaaaacacgtggtttatgtctggattgatgcc
ctcttaaactacgcgacagctcttggttatggtcaagctaatcacgctaactttgacaaa
ttctggaatggaacggttttccacatggttggaaaagatatcttacgttttcatagcatc
tactggccaatcttactcatgatgcttgatttaccaatgccagaccgcttaattgcccat
ggttggtttgtcatgaaagacggtaaaatgtctaaatcaaaaggcaatgtggtctatcca
gaaatgttagtggagcgctttggactggatcctcttcgttattacctcatgcgttctttg
ccagtgggttcagacgggacctttacccctgaagattatgtgggtcgtatcaactatgaa
ttggccaacgatcttggtaatttattgaatcgtaccgttgccatgatcaacaagtatttt
gacggcacggtgccagcttatgttgacaatggaactgcctttgatgctgacttaagtcaa
gtgattgatgctcagctagcagactaccataagcacatggaagcggtggactacccacgc
gccttggaggctgtttggaccatcattgctcgtaccaacaaatacattgatgagacagct
ccttgggtgctcgctaaagaagatggtgacaaggctcaactagccagtgtcatggcacac
ttggcagccagcttgcgcgtggtcgctcatgtgatccaaccctttatgatggaaacatca
gctgctatcatggcccagcttggcttagcgcctgtttctgacttgtcaacacttgctcta
gcagattttcctgccaatacaaaggtcgttgccaaaggcacaccgattttcccacgtctt
gatatggaagctgagattgactacatcaaagctcaaatgggtgacagctcagctatttcc
caagaaaaagaatgggtccctgaagaggttgcgctcaaatctgaaaaagacgtcatcaca
tttgaaacctttgatgctgtggaaatccgtgtggcagaagtcaaggaagtgtcaaaagtg
gaaggttcagaaaaattgctgcgctttagagtagatgcaggagacgggcaagaccgtcaa
atcttgtcaggtattgccaaatgctaccccaacgaacaagaattagtgggcaaaaaacta
caaattgttgctaacctgaaaccgcgtaaaatgatgaaaaaatacatcagtcaaggcatg
attttatcagcagagcatggagatcagctaacggtcttaaccgttgattcctctgttcca
aatggaagtatcattggctga

DBGET integrated database retrieval system