KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs1625
Entry
SPs1625           CDS       T00119                                 

Name
(GenBank) putative ABC transporter (ATP-binding protein)
  KO
K02071  D-methionine transport system ATP-binding protein
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
sps02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SPs1625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sps02000]
    SPs1625
Transporters [BR:sps02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   D-Methionine transporter
    SPs1625
SSDB
Motif
Pfam: ABC_tran NIL SMC_N AAA_21 TniB AAA_29 AAA_33 AAA_16 AAA_30 AAA_23 RsgA_GTPase NB-ARC MIT_C MMR_HSR1 AAA_22 AAA_15 SbcC_Walker_B cobW
Other DBs
NCBI-ProteinID: BAC64720
UniProt: P0CZ31
Position
complement(1622276..1623340)
AA seq 354 aa
MNEAIIQLDHIDITFRQKKRVIEAVKDVTVHINQGDIYGIVGYSGAGKSTLVRVINLLQA
PTNGKITVDGDVTFEQGKVQLSANALRQKRRDIGMIFQHFNLMAQKTAKENVAFALRHSS
LSKTEKEHKVIELLELVGLSERADNYPAQLSGGQKQRVAIARALANDPKILISDEATSAL
DPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAVMQNGVLIEEGSVLDIFSN
PKEALTQEFITTATGIDEALEKINQQDIVKHLPANALLAQLKYAGTSTDEPLLNSIYRQF
EVTANILYGNIEILDHIPVGDMIVVLEGQAENILAAEKALHEAGVDVSILKRGA
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaatgaagcaataattcaattagatcatattgatattaccttccgtcaaaaaaaacgg
gttatcgaagctgttaaagatgtcacggttcatatcaatcaaggagatatttatggcatt
gttgggtattcaggtgctgggaaatcaactcttgtgcgtgtgattaacctgctacaggca
ccaacaaacgggaaaatcactgttgatggggatgttacctttgaacaggggaaagttcag
ttatcagccaatgcccttcgtcaaaaacgacgtgatattggcatgatcttccaacatttc
aatttgatggcccaaaaaacagccaaagaaaatgtagcatttgcgctccgccattcatcg
ttaagtaagactgagaaagaacataaagttatcgagctgctagaacttgtaggtttatca
gagcgagcagataactaccctgcccagttatcgggtgggcaaaaacaaagggtggctatt
gcgcgtgctctagctaacgatccaaaaattttgatttcagatgaggccacatcagcacta
gatccaaaaaccactaaacaaattttggcgctcttgcaagaattaaaccgcaaacttggc
cttaccattgttatgattactcatgaaatgcaaattgttaaggatatttgtaatcgtgtt
gctgttatgcaaaatggtgttttgattgaagaaggttctgtccttgatatcttttcaaat
ccaaaagaagccttgacacaggaatttatcacaacagctacagggattgatgaggcttta
gaaaaaattaaccaacaagacattgttaaacatttgcctgcaaatgcccttctagctcag
ttgaaatatgcaggaacttctacggatgagcctctacttaatagcatttaccgtcaattt
gaagtgacagctaatattttgtatggcaatattgagattttagatcatattccagttggt
gacatgattgttgtcttggaagggcaagctgaaaatattcttgcggctgagaaagccttg
catgaagctggtgttgatgttagtattttaaagagaggagcctag

DBGET integrated database retrieval system