KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs1626
Entry
SPs1626           CDS       T00119                                 

Name
(GenBank) conserved hypothetical protein
  KO
K02073  D-methionine transport system substrate-binding protein
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
sps02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SPs1626
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sps02000]
    SPs1626
Transporters [BR:sps02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   D-Methionine transporter
    SPs1626
SSDB
Motif
Pfam: Lipoprotein_9 Phosphonate-bd NMT1 SecD-TM1
Other DBs
NCBI-ProteinID: BAC64721
Position
complement(1623590..1624435)
AA seq 281 aa
MSFKKWIGIVGIALASTVLVACSEKQDDKNTLTIGVMTKTESDQARWDKVEELLKKDNIT
LKYKEFTDYSQPNKAVANGEVDINAFQHYNFLNNWNKENKEHLVAIADTYISPINLFSGT
SQDGKAKYKSVADLPNGAQIAVPNDATNESRALYVLQSAGLIKLDVSGDQLATIANISEN
KKKLDIKELDASQTARALVSADAAVVNNSYAVPAKIDYKTSLFKEKADDNSKQWINIIAG
QKDWEKSEKADAIKKLIKAYQTDEVKKVVEKTSNGIDVSVW
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtcttttaaaaaatggattggaatagtcggaatcgctttagcatcaactgtattggtt
gcatgttctgaaaaacaagatgataaaaacactctaactattggggtgatgacaaaaaca
gaatctgatcaagcgagatgggataaagttgaagaattattgaaaaaagacaatatcact
ttgaagtacaaagaatttacagattactcgcaacctaataaggcagttgctaatggtgaa
gtcgatattaatgccttccaacactataatttcttaaataactggaataaggaaaataag
gaacatttggtggccattgctgatacctatatcagcccaattaaccttttctctggaacc
agtcaagatgggaaggctaaatacaaatcagtagctgatctgccaaatggtgctcaaatt
gcagtaccaaatgatgcgaccaatgaaagccgtgccctctatgtgctgcaatcagctggc
ctcattaaattggatgtgtctggtgatcaattagcaaccattgccaatatctcagagaac
aaaaagaaattagatatcaaggaattagatgctagccaaacggcacgtgctttagtatct
gctgatgcagctgttgtcaataatagttacgctgttcctgcaaaaattgactacaaaacc
tctcttttcaaagaaaaagcagatgacaattcaaaacagtggattaacattattgcaggt
caaaaagattgggaaaaatcagagaaggctgatgctattaaaaaactcatcaaggcctac
caaactgatgaggtgaagaaagtcgtggaaaaaacttcaaatggtatagatgtatccgta
tggtaa

DBGET integrated database retrieval system