KEGG   Sphingobacterium psychroaquaticum: E2P86_00930Help
Entry
E2P86_00930       CDS       T05967                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
spsc  Sphingobacterium psychroaquaticum
Brite
KEGG Orthology (KO) [BR:spsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spsc03016]
    E2P86_00930
Enzymes [BR:spsc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     E2P86_00930
Transfer RNA biogenesis [BR:spsc03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    E2P86_00930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: QBQ39792
Position
complement(218786..219469)
Genome map
AA seq 227 aa AA seqDB search
MLDILYKDLEIIAINKPHGLLVHRSSIAADTSEFALQLLRDQIGQAVYPAHRLDRKTAGA
LLFSLTKEMDSQLQNLFATRQTNKTYWAIVRGYTEDTFSVDYPLKKENGTLQDALTHFRT
LHRAELPIPQGKHTTSRYSLVEALPITGRMHQIRRHLAHVFHPIIADRPHGCNKQNKFWK
ETFKMDSMMLHAKELSFVHPSNQSTITIEAPLHSEFERVLQLLNIEP
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatattctatataaagacctagagattatcgcaatcaacaagccccatgggcta
ctggtgcaccgatcgtcaattgctgccgacacctccgaatttgcattacagttgctgcgc
gatcaaattggacaagccgtttacccggcccatcgactggaccgaaagacggctggtgcg
ttactcttttcccttacaaaagagatggattcacaactccaaaacctctttgcaacacgt
caaacaaataaaacctattgggctattgtacgcggatatacggaagatactttctcagtc
gattatccattaaaaaaagaaaatggaacgttacaagatgcactcacacatttccggacg
ttgcatcgcgccgagctgccgataccacaaggaaaacataccacttctcgctattcgttg
gttgaagcgctaccgataacgggccgcatgcaccagatccgtcgtcatctggcacatgtt
ttccatcctatcattgctgatcgtccacacggttgcaacaagcaaaacaagttctggaaa
gagaccttcaagatggatagcatgatgctacatgccaaggagctcagcttcgtgcaccct
tcgaaccaatcgacgataaccattgaggcacctttgcattccgaattcgaacgtgtcctt
caattgttaaatatagaaccatga

DBGET integrated database retrieval system