KEGG   Sulfitobacter pseudonitzschiae: SULPSESMR1_00270Help
Entry
SULPSESMR1_00270  CDS       T04974                                 

Gene name
ddc
Definition
(GenBank) L-2,4-diaminobutyrate decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
spse  Sulfitobacter pseudonitzschiae
Pathway
spse00350  Tyrosine metabolism
spse00360  Phenylalanine metabolism
spse00380  Tryptophan metabolism
spse01100  Metabolic pathways
spse01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SULPSESMR1_00270 (ddc)
   00360 Phenylalanine metabolism
    SULPSESMR1_00270 (ddc)
   00380 Tryptophan metabolism
    SULPSESMR1_00270 (ddc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spse04147]
    SULPSESMR1_00270 (ddc)
Enzymes [BR:spse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     SULPSESMR1_00270 (ddc)
    4.1.1.105  L-tryptophan decarboxylase
     SULPSESMR1_00270 (ddc)
Exosome [BR:spse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SULPSESMR1_00270 (ddc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ASM71106
UniProt: A0A221JWL1
Position
complement(300881..302275)
Genome map
AA seq 464 aa AA seqDB search
MNWDDFATHAKDVADWGADYHKTIRDRPVRAQTAPGDVSSQLPDSPPEDGTDMANIMADF
EKVVMPGITHWQHPRFFAYFNSNAAPASVLAEFVASIIAPQCMLWQTSPAATEMETRMLD
WLRQGLGLPDGYQGVIQDSASSATLAAVLTMRERALNWQGNVQGLSGQPVLRIYCSDQVH
TSIDRAIWVAGIGQDNLVKIRSTGDLRGLDPIALQDAITRDRAAGFVPAGIIAATGATGM
GACDDLDAVANIAKAENLFTHLDAAWAGTAMICPEFRPLWQGAERFDSIVFNPHKWLGAQ
FDCAAHFLRDPDVLRQTLAIRPEYLKTHAQGDIIDYSEWSIPLGRRFRALKLWFLMRSYG
MEGLRSRIRNHVTWSQALCERLRALPEFQIVTDPILSLWTFKPAGASDEDTQALVEAINT
DGRIYLTQTLVDGVKVIRFTAGQFDCEERDFDTAFDTITEIARR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggatgatttcgccacccacgccaaagacgtcgccgactggggcgcggattat
cataaaacaatacgagaccgtccggtccgcgcgcaaaccgcgcccggcgatgtgtcgtca
caactgcccgacagcccccccgaggacggtaccgacatggccaacatcatggccgacttc
gagaaggtcgtgatgcccggaataacccactggcagcacccgcgtttctttgcctacttc
aactcgaacgccgcccctgcatcggtgctggcggaatttgtcgcctcgatcatcgcaccc
caatgtatgctgtggcaaacctcgcctgcggcaaccgagatggaaaccagaatgctggac
tggctgcgtcaggggctgggcctgcccgacggctatcagggcgtcattcaggacagcgcc
agcagcgccacgctggcggccgtgctgaccatgcgcgaacgggcgctgaactggcagggc
aatgtgcagggcctgtcgggccagcctgttctgcgcatctattgttcggatcaggtccat
acctcgatcgaccgcgcgatctgggttgcgggcattggtcaggacaatctggtgaaaatc
cgcagcaccggcgatctgcgtgggctggaccctattgcgctgcaagatgcgatcacccgc
gaccgcgcggcgggctttgtccctgcgggtatcatcgccgccacaggtgccaccggcatg
ggggcctgcgatgatctggacgccgtggccaacatcgccaaggccgagaacctctttacc
catctcgacgccgcatgggcaggcaccgcgatgatctgccccgaatttcgcccgctatgg
caaggggccgagcgtttcgacagcatcgtgttcaacccgcacaaatggctgggcgcgcag
ttcgattgcgccgcccatttcctgcgcgaccccgacgtgttgcgtcagacgctggcaatc
cggcccgagtatctgaaaacccacgcccaaggcgacatcatcgactattccgaatggtcg
atcccgctgggtcgccgctttcgcgcgctgaaactgtggttcctgatgcgcagctatggc
atggaaggactgcgcagccgtatccgcaaccatgtgacatggtcccaagccctgtgcgaa
cgcctgcgcgccctgcccgagtttcagatcgtcactgatccgatcctgtcgctgtggacc
tttaaaccggccggtgccagcgacgaagacacccaagcgctggtcgaggcgatcaacacc
gacggacgcatctacctgacacagacccttgtggacggggtcaaggtcatccgcttcacc
gcagggcaattcgactgcgaagaacgcgactttgacaccgcctttgacaccataaccgag
attgcgagacgctga

DBGET integrated database retrieval system