KEGG   Sulfitobacter pseudonitzschiae: SULPSESMR1_04188Help
Entry
SULPSESMR1_04188  CDS       T04974                                 

Gene name
bktB
Definition
(GenBank) beta-ketothiolase BktB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spse  Sulfitobacter pseudonitzschiae
Pathway
spse00071  Fatty acid degradation
spse00072  Synthesis and degradation of ketone bodies
spse00280  Valine, leucine and isoleucine degradation
spse00310  Lysine degradation
spse00362  Benzoate degradation
spse00380  Tryptophan metabolism
spse00620  Pyruvate metabolism
spse00630  Glyoxylate and dicarboxylate metabolism
spse00640  Propanoate metabolism
spse00650  Butanoate metabolism
spse00900  Terpenoid backbone biosynthesis
spse01100  Metabolic pathways
spse01110  Biosynthesis of secondary metabolites
spse01120  Microbial metabolism in diverse environments
spse01130  Biosynthesis of antibiotics
spse01200  Carbon metabolism
spse01212  Fatty acid metabolism
spse02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SULPSESMR1_04188 (bktB)
   00630 Glyoxylate and dicarboxylate metabolism
    SULPSESMR1_04188 (bktB)
   00640 Propanoate metabolism
    SULPSESMR1_04188 (bktB)
   00650 Butanoate metabolism
    SULPSESMR1_04188 (bktB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SULPSESMR1_04188 (bktB)
   00072 Synthesis and degradation of ketone bodies
    SULPSESMR1_04188 (bktB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SULPSESMR1_04188 (bktB)
   00310 Lysine degradation
    SULPSESMR1_04188 (bktB)
   00380 Tryptophan metabolism
    SULPSESMR1_04188 (bktB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SULPSESMR1_04188 (bktB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SULPSESMR1_04188 (bktB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SULPSESMR1_04188 (bktB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spse04147]
    SULPSESMR1_04188 (bktB)
Enzymes [BR:spse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SULPSESMR1_04188 (bktB)
Exosome [BR:spse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SULPSESMR1_04188 (bktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASM75380
UniProt: A0A221K936
Position
pSMR1-4:complement(134873..136054)
Genome map
AA seq 393 aa AA seqDB search
MTDVVILDGARTAIGTFGGSLAGTSPIELGTIVAKAALERSGLKADQIGQVVFGHVINTE
PRDMYLSRVVAMQAGVPASAPAMNVNRLCGSGAQAIVSAAQSLMLGDADFALAGGAECMS
RSPHIIPQARWGQKMGDITAVDMMLGALTCPFGSGHMGVTAENVATELQITRADQDAFAL
TSQARAARAIGDGSFKREITAVELKTRKGTAVFDTDEHPKATTAEALAGLKPVFRKGGSV
TAGNASGINDGAAAMVLARADAAKKAGLQPRARILGYSIAGVDPEVMGIGPIPAVQALCA
RTGLNIADFDVIESNEAFAAQALAVNKVLGLNPEKVNPNGGAIALGHPISATGAILTLKA
LNALDSFGGTKALITMCIGGGQGIAIAIEKLGD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgttgtaattcttgatggcgcacgcaccgccattggtactttcgggggtagc
cttgcaggaacctcgccaatcgaactgggaacaattgtagccaaagcggcgctagaacgt
tcaggtttaaaggctgatcaaatcggccaggtggtgtttggtcacgtcattaataccgag
ccacgggatatgtacttgtcgcgcgtggtcgcaatgcaggctggtgtgccggcaagcgcc
cccgcaatgaatgtcaacaggttgtgcggatccggcgctcaggcgattgtttcggccgcg
cagtcgttgatgttgggcgacgccgatttcgcccttgcaggcggcgctgaatgtatgagc
cgctccccccatatcattccgcaggcgcggtggggacagaaaatgggtgatatcaccgcg
gtggacatgatgttaggcgcgctgacgtgcccttttggatccgggcatatgggtgttacg
gccgaaaacgtggcgactgagctgcaaattacacgggctgaccaagacgcctttgcgctg
accagccaagcccgcgcggcaagagcgattggtgatggtagctttaagcgagaaatcacg
gcagttgaattgaaaacccgcaaaggcactgctgtgtttgacacagatgaacaccctaag
gcgacgactgcggaggcgctggccgggctgaagcccgtgttccgcaagggcggcagcgtg
acagcaggaaatgccagcgggattaacgatggtgctgccgcgatggttctagcacgggct
gacgcagcaaaaaaagctggtctgcagccgcgggcgcgcattttgggttactcgattgcc
ggagtggaccccgaagttatggggatcggcccaattccggccgtacaggcgctatgcgca
cgcaccgggctgaacatcgctgatttcgacgtgatagaatcaaacgaggcgttcgctgcg
caggccctggctgtgaataaagtgcttggtttgaatccggaaaaggtaaatccgaacggc
ggagcaatcgcgcttggccatccgattagcgccactggagcgatcctgactctgaaagcc
ctcaatgcccttgacagttttggtggaacgaaggctctgatcacaatgtgtattgggggc
ggtcaggggatcgcgattgcaatagaaaaactgggggattga

DBGET integrated database retrieval system