KEGG   Shewanella psychrophila: Sps_01122Help
Entry
Sps_01122         CDS       T05063                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
spsw  Shewanella psychrophila
Pathway
spsw00030  Pentose phosphate pathway
spsw00480  Glutathione metabolism
spsw01100  Metabolic pathways
spsw01110  Biosynthesis of secondary metabolites
spsw01120  Microbial metabolism in diverse environments
spsw01130  Biosynthesis of antibiotics
spsw01200  Carbon metabolism
Module
spsw_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
spsw_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
spsw_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sps_01122
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Sps_01122
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spsw04147]
    Sps_01122
Enzymes [BR:spsw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Sps_01122
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Sps_01122
Exosome [BR:spsw04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Sps_01122
  Exosomal proteins of colorectal cancer cells
   Sps_01122
  Exosomal proteins of bladder cancer cells
   Sps_01122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AQS36304
UniProt: A0A1S6HLD0
Position
complement(1240435..1241907)
Genome map
AA seq 490 aa AA seqDB search
MGITTPEAKACDFVLFGTKGDLARRKLLPSLYQLDKAGLLNIDTKVLGVAKDGFTQEEFK
ALVDKALKTFVKEELCEETVERFLQRCHYVGTNFTESEGYKPFHDILEPEKRVMVSYFAT
PPAIFGDICRCLHEQNLIYPDSRVVLEKPIGYDLESSKVINDHVSAFFNENQIYRIDHYL
GKETVQNLIALRFANSLFASKWDNRTIDHVQITVAEEVGIEGRWGYFDKAGQMRDMIQNH
LLQVLTLVAMDPPVDLDADSIRDEKVKVLKSLRPINSDNIYENTVRGQYSSGFLQGSPVP
GYLEEEGANTQSNAETFVALRIDIDNWRWAGVPFYLRSGKRMPAKSSEIVVSFKNPPHNL
YRSSYRNLPPNKLTIRLQPHEGVEIQMMNKVPGLEQKQRLQTTKLDLSFSDTFKNERIAD
AYERLLLEAMLGNQALFVRRDEVEQAWTWVDGIIQAWEESNEKPKPYPAGSWGPVASVAL
IAKDGRSWDE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgggcataacaacaccagaagccaaagcttgtgattttgtattgtttggtactaaaggt
gatttagcgcggcgtaaattacttccctctttatatcagttagacaaagcgggactgcta
aatatcgatactaaggtacttggtgtcgctaaagatggttttactcaagaagaatttaaa
gcgttagtcgataaggctctcaagaccttcgtgaaagaggaactctgtgaagagactgtc
gaacgtttcttacaacgctgccattatgtaggtactaattttacggagtcagaaggttac
aaacctttccatgatatactagagcccgaaaagcgggtgatggttagctatttcgcgacg
ccaccggctatttttggtgatatctgtcgctgtcttcatgaacaaaatttgatttatccc
gattctcgtgtggttttagaaaaacccatcggctacgatctcgaatcttctaaagttatt
aacgaccatgtttctgccttcttcaatgaaaatcaaatttaccgtatcgatcactatcta
ggtaaagaaactgttcagaatcttatcgcacttcgttttgccaattcattgtttgcctca
aaatgggataaccgcaccatagatcatgtacagatcaccgttgccgaagaggtaggtatc
gaaggtcgttggggttacttcgataaggcgggtcagatgcgagacatgatccagaatcat
ctgttgcaggtactgacactggttgctatggaccctccggttgacttagatgctgacagc
attcgtgatgaaaaggtcaaagtgctcaaatcccttcgtcctatcaattctgacaatatc
tatgagaatacggttcgtggtcaatactcatcgggattcttgcaaggttcaccggttccc
ggatacctcgaagaggagggcgctaatactcaatctaatgctgagactttcgttgcctta
agaattgatatcgacaattggcgttgggccggggtgccattttatcttcgtagtggtaag
cgtatgcctgccaaaagttctgaaattgtcgtttctttcaagaatccgccccataaccta
taccgctcaagctataggaacttaccgccaaataaattgactattcgactccagccccat
gaaggtgtcgaaattcagatgatgaacaaggtaccaggccttgaacaaaagcaacgacta
cagacgactaaactcgatttaagcttctcggatacctttaaaaacgaacgtatcgccgat
gcctatgagcgtctgttactcgaggctatgttgggtaatcaagcgctatttgtgcgtcgt
gatgaagtcgaacaggcttggacttgggttgacggaattattcaggcttgggaagaaagc
aatgagaagccaaaaccctatcctgccggcagttggggccctgtggcatccgttgctcta
atagcaaaagacggccgttcttgggacgagtaa

DBGET integrated database retrieval system