KEGG   Shewanella psychrophila: Sps_01167Help
Entry
Sps_01167         CDS       T05063                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
spsw  Shewanella psychrophila
Pathway
spsw00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Sps_01167
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spsw01007]
    Sps_01167
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spsw03016]
    Sps_01167
   03029 Mitochondrial biogenesis [BR:spsw03029]
    Sps_01167
Enzymes [BR:spsw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Sps_01167
Amino acid related enzymes [BR:spsw01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Sps_01167
Transfer RNA biogenesis [BR:spsw03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Sps_01167
 Prokaryotic Type
   Other AARSs
    Sps_01167
Mitochondrial biogenesis [BR:spsw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Sps_01167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: AQS36339
UniProt: A0A1S6HLF5
Position
complement(1284599..1286386)
Genome map
AA seq 595 aa AA seqDB search
MRSQYCGDVNKSHVGQEVTLVGWVNRSRDLGGVVFLDLRDREGIVQVVYDPDLPEVFDVA
SSLRSEFCVQITGLVRARPDSQINDQMRTGEIEILGKGLTILNSSAPLPINMDKNQHNTE
EQRLKYRYLDLRRPEMAERIVFRSKVTSAVRRFLDGNGFLDIETPILTKATPEGARDYLV
PSRTYKGQFFALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDIETSF
MTSEQVMAKTEEMMRSLFQELLNVDLGEFPRMTFAEAIRRFGSDKPDLRNPLELIDVADL
LTDVDFKVFQGPATDPEGRVAVICVPGGAKLSRKQLDQYAKYVTIYGAKGLAWMKVNELD
KGLEGIQSPVLKFLNEDVVKGLLERTNAKSGDLILFGADKANIVAEAMGALRLKAGEDFD
LLKGDWKPLWVVDFPMFEPTSDGGLHAMHHPFTAPSGMTPEQLEADPTAAISDAYDMVLN
GCELGGGSVRIHNSEMQTAVFRILGIEAEEANEKFGFLLEALRYGTPPHAGLAFGLDRII
MLMTGASSIRDVMAFPKTTTAACPLTNAPGLANPEQLVELGISVIKDEEEKEIQE
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagtcaatattgtggagacgttaacaagtctcacgttggacaagaagtgacccta
gtgggttgggtaaatcgtagccgtgaccttggtggtgtggtttttctcgacttaagagac
agagaagggattgtacaggttgtttatgatccggatttacctgaagtgttcgacgttgcc
agtagcctgcgcagtgaattttgtgtccagatcacgggtttggttcgtgctcgccccgat
agtcagatcaatgatcagatgcgtactggtgagattgagatcttaggcaaaggcttaact
attttaaacagctcagcacctctgcccattaacatggacaaaaatcagcacaacacggaa
gagcagcgacttaaatatcgttatttagacctgcgtcgtccagagatggctgaacgcatc
gttttccgctctaaagtcactagtgccgtgcgtcgattcctcgatggtaatggcttcctc
gacattgaaacgcctatcttgaccaaggcgacgcccgaaggcgctcgagattatttagtg
cctagccgtacttataaggggcaattttttgcgttgcctcagtcaccacagttgtttaaa
cagttgttgatgatgtctggcttcgatcgctactatcaaatcgttaagtgttttcgcgat
gaagacttacgtgcagaccgtcagccagagttcacccaaattgatattgaaacttcgttt
atgacctctgagcaggtcatggcgaaaactgaagagatgatgcgtagtcttttccaagag
ctgttaaatgtcgatcttggtgaatttcctaggatgacgtttgccgaagctataagacgc
ttcggttccgataaacctgatcttcgtaacccattagaacttatcgatgttgccgattta
cttacggacgtcgacttcaaggtgttccagggacctgctaccgatccagagggacgtgtg
gctgtgatttgtgtgcctggtggtgccaagctatctcgtaagcaattagaccaatacgcc
aagtatgtcaccatttatggagctaaaggtttagcatggatgaaggtcaacgagcttgat
aaaggcctcgagggcattcaatcaccagtacttaagttccttaacgaagatgttgttaag
ggcttacttgagcgtacgaatgctaagtccggtgatctgattttatttggcgcagataag
gcaaacatcgttgctgaagctatgggtgcactgcgcttaaaagccggtgaagattttgat
ctattaaagggtgattggaaaccattgtgggttgttgacttccctatgttcgagcccact
tcagatggtggactgcatgccatgcatcatccatttaccgcgccgagtggtatgacgccg
gagcaactggaagctgacccaactgcggctatctcagatgcctatgatatggtgttaaat
ggctgtgaactcggcggtggctctgtgcgtatccataacagtgagatgcagaccgcagtg
ttccgtattctaggtatcgaagcagaagaagctaacgagaagtttggtttccttttagaa
gcactgcgctacggtactccacctcatgccggtttggcttttggtttagatagaatcatc
atgttgatgactggtgcttcctctattcgtgatgtgatggcattccctaagacgacgact
gcggcttgtcctttgactaatgcaccagggcttgctaatcctgaacaactcgtcgagtta
ggtattagcgtcatcaaagacgaagaagagaaagaaatacaagagtaa

DBGET integrated database retrieval system