KEGG   Shewanella psychrophila: Sps_02027Help
Entry
Sps_02027         CDS       T05063                                 

Definition
(GenBank) aconitase/2-methylcitrate dehydratase (trans-methylaconitate-forming)
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
spsw  Shewanella psychrophila
Pathway
spsw00640  Propanoate metabolism
spsw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Sps_02027
Enzymes [BR:spsw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     Sps_02027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AQS37187
UniProt: A0A1S6HNT9
Position
complement(2276917..2279523)
Genome map
AA seq 868 aa AA seqDB search
MNTQFRKPLPGSSLDFFDTQAAVDAISPGAYSKLPYCSRVYAENLVRRCEPAKLTDSLKQ
IIERKQDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEKGGDPSKVNPVVPTQLIVDH
SLAVEHAGFEKDAFEKNRAIEDRRNDDRFHFINWTKTAFKNIDVIQPGNGIMHQINLEKM
SPVVQSRDGVAFPDTLVGTDSHTPHVDALGVIAIGVGGLEAESVMLGRPSYMRVPDIVGV
ELVGKRQSGITATDIVLAITEFLRGEKVVSTYLEFFGEGARALTLGDRATISNMTPEFGA
TAAMFYIDEMTIDYLKLTGRDDSQVKLVENYAKQAGLWADTLENVEYERVLRFDLSSVGR
NIAGPSNPHKRVSTSELAAAGITGKVEQDGKLMPDGACIIAAITSCTNTSNPRNVIAAGL
IARNANAKGLTRKPWVKTSLAPGSKAVQLYLEDAKLLSELEQLGFGIVGFACTTCNGMSG
ALDPVIQQEVIDRDLYTTAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIE
KDVLGKDSQGNDVTLKDIWPSDEEIDAVIAQSVKPEQFRKVYEPMFDIKVEYGSDNDPQY
EWRPQSTYIRRPPYWEGALAGERTMKGMRPLAVLGDNITTDHLSPSNAIMLESAAGAYLD
KMGLPEVDFNSYATHRGDHLTTQRATFANPKLFNEMVTQLGKNGKAEVKQGSYARIEPEG
LESRMWEAIETYMERKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEVIVAEGFERIHRTN
LVGMGVLPVEFTSGENRHTYGIDGSETYDVIGQRMPGAALTLIITRKNGDQVEVPVKCRL
DTAEEVSIYEAGGILQRFAQDFLDSNVN
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccaattccgtaaaccgcttcctggcagctccctcgatttttttgatacccaa
gctgctgtcgatgctatctctcctggtgcctatagcaagctgccttattgttctcgtgtc
tacgccgagaacctggttcgtcgctgcgagcctgctaaactgaccgattcactgaaacag
atcatagagcgcaagcaagatttggactttccatggtatccggctcgcgtggtgtgtcac
gatattcttggtcagacggcgttagtcgatctggctggtttgcgtgatgctattgccgag
aagggcggcgatccgtctaaagtgaatcctgttgtaccgactcagctgattgttgatcac
tcgcttgcggtggaacacgctggatttgagaaagatgccttcgagaagaatcgtgccatc
gaagacagacgcaacgatgacagatttcactttatcaattggactaagacggcatttaaa
aacatagatgttattcagccgggtaacggcatcatgcatcagattaacctggaaaaaatg
tcaccggttgtccagtcccgtgatggtgttgcatttcccgataccttagtcggtacagac
agccacacgccacatgtggatgcccttggggttattgccataggtgtgggcggtcttgaa
gctgaaagtgtgatgcttgggcgtccttcttacatgcgtgtgccggacattgtcggagtt
gagctggtgggtaaacgccagagcgggatcaccgcgacggatatcgtccttgctatcacc
gagtttttacgtggtgagaaagttgtatcgacctatttagagtttttcggtgaaggagcc
agagcgctgacattgggcgatcgcgccactatttctaacatgaccccggaatttggcgcc
actgccgccatgttctatatcgacgagatgaccatagattatctcaagctgacaggccgg
gatgatagccaggtaaaactggtcgagaactatgccaaacaagctggtttgtgggctgac
acgctagaaaatgtcgagtacgagcgtgtactgcgttttgacttatcatcggttggtcgt
aacatcgccggaccttcaaaccctcataagcgtgtttccaccagtgaactggcggctgct
gggatcacaggaaaagtggaacaagacggtaagttgatgccagatggcgcctgtatcatc
gccgccatcactagctgtactaacacttcaaatccccgtaacgttattgctgcaggcctt
atcgcccgtaatgctaacgctaaagggttaacccgtaagccttgggtgaaaacctcactg
gcacctggctcgaaagcggtgcagctttatcttgaagatgccaaattattgtcagagttg
gagcaactcggtttcggtatcgtcggttttgcctgtaccacctgtaatggtatgagcggc
gcgttagatcctgttattcaacaagaagtgatcgacagagacttgtacaccacggcggta
ctttcgggtaaccgtaatttcgatggccgcatccatccttacgccaaacaagctttctta
gcatcaccacctttagtcgtagcctacgccattgccggtactattcgtttcgatatcgaa
aaagatgtacttggcaaagacagtcagggcaatgatgtgactttgaaagatatctggccc
agtgatgaagagatagacgcggtcatagctcaaagtgttaaacctgagcaattccgtaag
gtctatgagcctatgttcgatattaaagtcgaatatggcagcgacaacgacccgcaatat
gagtggcgtccacagagtacttacattcgccgtcctccctactgggaaggcgcactcgcg
ggcgagcgtaccatgaagggcatgcgtcctctggcagtacttggtgacaacatcactacc
gatcacttgtctccttcgaacgccatcatgcttgagagtgccgcaggtgcttatttggat
aaaatgggtttacctgaggtggactttaactcctatgcgacccacaggggcgatcattta
acgacccaacgagctacttttgcgaatcctaagttgtttaacgagatggtgactcagctt
ggtaagaatggcaaggctgaagttaagcaaggctcatacgcccgtatcgaacccgaaggg
ctcgagtctcgcatgtgggaagctatcgagacctatatggagcgcaaacaaccgttgatc
atcatagctggtgcagattacggtcaaggttcatctcgtgactgggccgccaaaggcgta
cgccttgcgggtgtcgaagtgattgttgccgaagggtttgagcgtattcaccgcaccaac
ttagtcggtatgggagtactgcccgtggagttcactagtggtgagaaccgtcatacttat
ggcatcgatggcagcgaaacatatgacgtaattggtcagcgcatgccaggggctgcatta
acgctaatcatcactcgtaagaatggtgatcaggttgaagtgccagttaagtgccgtcta
gataccgctgaagaagtatcaatctatgaggctggtggaattctacaacgcttcgcccaa
gactttctggactcaaatgtaaattaa

DBGET integrated database retrieval system