KEGG   Shewanella psychrophila: Sps_02955Help
Entry
Sps_02955         CDS       T05063                                 

Definition
(GenBank) aspartate kinase
  KO
K12525  bifunctional aspartokinase / homoserine dehydrogenase 2 [EC:2.7.2.4 1.1.1.3]
Organism
spsw  Shewanella psychrophila
Pathway
spsw00260  Glycine, serine and threonine metabolism
spsw00261  Monobactam biosynthesis
spsw00270  Cysteine and methionine metabolism
spsw00300  Lysine biosynthesis
spsw01100  Metabolic pathways
spsw01110  Biosynthesis of secondary metabolites
spsw01120  Microbial metabolism in diverse environments
spsw01130  Biosynthesis of antibiotics
spsw01230  Biosynthesis of amino acids
Module
spsw_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
spsw_M00017  Methionine biosynthesis, apartate => homoserine => methionine
spsw_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sps_02955
   00270 Cysteine and methionine metabolism
    Sps_02955
   00300 Lysine biosynthesis
    Sps_02955
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Sps_02955
Enzymes [BR:spsw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     Sps_02955
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     Sps_02955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Homoserine_dh NAD_binding_3 DUF562
Motif
Other DBs
NCBI-ProteinID: AQS38102
UniProt: A0A1S6HRG6
Position
complement(3384650..3387037)
Genome map
AA seq 795 aa AA seqDB search
MARCHLHKFGGSSLADADCYRRVAHILLTHGNSDDLVVVSAAGKSTNFLYKLLELKDTGQ
LWQEELQVLISFQQNLIEQLLSNEQARSLRERLSIDKYQLISLFSLESLNEYKRSEVVSF
GERWSARLLAALLRESGVAASDVDARSLLLADEGGVPQIRLDESRSRVQKTLGEHPNERL
IITGFICANSRGETLLLGRNGSDYSATLIASLANIERVTIWTDVEGVFNADPNKINDAKL
LKSLSLDEANRLAHLGSPVLHNRSLQPLFDTQVSLAVRSSYASHTDFTLIAPKSSQASAP
VVTNLSSVSLFSFRISSDTANLAELLEVAGLIPLAHWKLAHNRVELAFTHENQKQVQAIL
ATDALEVSDIHIREDLGLVALVSADAGLYRRGFARLLSRDARPLFKDGLSLVTLVPTSQV
NLLTQKVHRRCAGPRKRIGVLLLGVGNIGETWARLFSRARVALNKELEASVELVGLLSSK
KALLKEEGIDLDSWKQAFDEQATPWLYDHMFEQLQALECDELIALDISASADLTLQYPEF
FSRGIHVVSANKLAGSGPLAFYRELKLQLGNRRLFWRYNASCGAGLPVQHALNDLHNSGD
SIEAVGGIFSGTLCWLFEKYDAKKPFSELVLEARGLGITEPDPRDDLSGRDMQRKLLILA
REIGHEIELEDIELHSLVPADLADIPLEQFLARISELDGDMLQQFQTAAEQSKVLRYVAG
LDVVDGQLKAAVRMEWVDTQHAYANLTPGDNVFVIRSAFYQDNPLIIRGPGAGREVTAAA
VQSDLAQICRDLVQE
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgttgtcatttgcacaaatttggtggttctagcttagcggatgcagattgctac
cgccgtgttgctcatatccttctcactcacggcaatagcgatgatctcgtcgttgtatcg
gccgcaggtaagagcaccaattttctttataaattattggaactcaaagacactggtcag
ctatggcaggaagagttgcaggtgttaatcagctttcaacagaatctgatcgaacagctg
ctttctaacgagcaggccagaagcctgagagagcgtttgtctatcgacaagtatcagctc
atcagtctgttttctctagagtcgttaaacgagtataaaagaagtgaagtggtgagcttt
ggtgagcgttggtccgctcgtctcttggctgctttactcagagagtccggcgttgcagca
tcagatgtcgatgccagaagcttgttgctagccgatgaaggaggcgtgccgcagatcaga
ctcgatgaatctcgatcacgagttcagaaaacccttggtgagcatcccaacgaaagattg
attatcacaggctttatctgcgccaacagccgtggcgaaaccttactactagggcgtaat
ggttcagattatagtgcgaccttgattgccagtttagctaatatcgaacgtgtcaccatc
tggactgatgtggaaggtgtattcaacgccgatccaaacaagattaacgatgccaaacta
cttaagagcctatctttagatgaagctaatcgcttagcgcatctgggctcacccgtgctg
cataaccgttctctacagcccctatttgacactcaagtgagtctggctgttcgttccagc
tatgcctctcataccgatttcaccttaattgcaccaaagagctctcaagccagtgctccg
gtggtgactaatctgtccagtgtctctctgtttagtttcagaatcagtagtgatactgct
aatttggctgagttattggaagtggctggcttgatcccgttagcccattggaagttggct
cataaccgagttgagctggcttttacccatgagaatcagaaacaagttcaagctatcctg
gcaaccgatgccctggaagtttctgacatacatattcgagaagatctaggtttagtagcc
ttggtcagcgccgatgccgggctgtaccgccgtggcttcgctcgactgctgagcagagat
gcaagaccattgtttaaagatggtttaagtctggtgactttagttccgacatcacaagtt
aacctgctgactcaaaaagtgcatcgtcgttgcgctggtcctcgcaagcgcataggtgtg
cttctgcttggggtgggtaatattggtgagacttgggctcggctgttcagccgagctaga
gttgcactcaataaagagttagaagctagcgttgagctggtgggtttactcagttctaag
aaggctttattaaaagaggaagggatagatctcgactcatggaaacaggcgtttgacgag
caagctactccttggctctatgatcatatgtttgagcagctacaagcactcgaatgtgac
gaactcatcgccttagatatcagtgctagcgccgacttaacgctgcaatatcctgagttc
ttctcacgtggcattcatgtggttagcgcaaacaagctagcgggttcagggcccttagct
ttttatcgagagcttaagttacagttaggcaatcgtaggttattttggcgttacaatgcc
agttgtggtgcaggtttaccggtacagcacgcattgaatgatctgcataacagcggtgat
agtatcgaagctgttggtggtatattttctggcaccttgtgttggttattcgagaagtat
gacgctaagaagccgttctctgaactcgtgttagaggctagagggctaggtattaccgag
ccggaccctcgtgatgatctgtccggtcgagacatgcagcgaaaattgttgatcttggct
cgcgagattggtcatgagattgaactggaagatattgaacttcattcattagtgccagct
gatctagccgatattccattggaacagtttttagcgcggatctcagaactcgatggagat
atgttgcagcagtttcagacagcggcagagcaaagtaaggtcttgagatatgttgccgga
ctcgatgttgttgatggccagcttaaggctgctgttagaatggagtgggtcgacactcaa
catgcctatgcaaatctaactccaggcgataatgtttttgtgatacgcagtgccttctat
caagacaaccctttaattatcagaggccccggtgccgggcgtgaagtgactgcagctgct
gtacagtcagatctggcgcagatttgtcgggatttagtgcaagaatag

DBGET integrated database retrieval system