KEGG   Shewanella psychrophila: Sps_03666Help
Entry
Sps_03666         CDS       T05063                                 

Definition
(GenBank) Phenylalanine 4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
spsw  Shewanella psychrophila
Pathway
spsw00360  Phenylalanine metabolism
spsw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spsw00790  Folate biosynthesis
spsw01100  Metabolic pathways
spsw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Sps_03666
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sps_03666
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sps_03666
Enzymes [BR:spsw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Sps_03666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AQS38784
UniProt: A0A1S6HTI0
Position
complement(4192740..4193537)
Genome map
AA seq 265 aa AA seqDB search
MSKNTEYVARLPDADGHIDYPQVEHDTWQALYVRQQGNLSEYACNEYQQGLIDLGLSANN
IPQLQNIDKVLLSMTGWKTAAVPALISFERFFELLANREFPVATFIRSKDEFDYLREPDI
FHEVFGHCPLLTNESFAKFSHAYGKLGLAASKEDRVLLARLYWFTVEFGLIRNRDDSLSI
YGGGILSSPGETLYAMGAEPQIKPFNLVDVLRTPYRIDIMQPVYYAVDGLSFLDEIVEMD
IMGAVAEAKKLGLFAPLYEPKSKAS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaatacagagtatgtggctcggttaccggatgccgatggccacatagattac
cctcaagtagagcatgacacttggcaagccttgtatgtgagacagcagggaaatttatct
gaatatgcctgcaacgagtatcagcaaggtctgatagatcttggcttgtcggccaataac
attccacagcttcagaatatcgataaggtattgttgagtatgacgggctggaaaacggct
gccgtgcctgcattgatctctttcgagcgcttctttgagctattggctaaccgcgagttt
cctgtagcaaccttcattcgcagtaaagatgaatttgattatttaagagagcctgacatt
ttccatgaggtgtttggtcattgtcccctgttgaccaacgaatcttttgccaaattttca
catgcctatggaaagttaggtttagcagcgagcaaggaggacagggtattactggctcgt
ttgtactggtttaccgtcgagtttggtctgatccgcaatcgagatgattccttgtctatc
tatggtggtggtatattgagttcaccgggagaaaccttatatgcgatgggagctgagcca
cagattaaaccttttaaccttgtggacgtattaagaacaccttatcgcatcgatattatg
caacctgtctattacgccgtcgatggcctatcgtttctcgatgaaatcgttgagatggat
atcatgggtgccgtagccgaagccaaaaagctaggcttgtttgctcccctatatgagcca
aagtctaaagccagttaa

DBGET integrated database retrieval system