KEGG   Shewanella psychrophila: Sps_04645Help
Entry
Sps_04645         CDS       T05063                                 

Definition
(GenBank) uncharacterized protein affecting Mg2+/Co2+ transport
  KO
K06195  ApaG protein
Organism
spsw  Shewanella psychrophila
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Sps_04645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AQS39730
UniProt: A0A1S6HVY3
Position
5266919..5267299
Genome map
AA seq 126 aa AA seqDB search
MSELGSTIKVEVKTEYIEEQSSPKEERYLFRYTITIINLGQTAVTLESRHWRITDSNDHK
SEVQGAGVVGETPRIEPDTAYQYTSGTVLETPLGVMQGTYTMVTDDGEQFQAIIHPFRLS
VPGLLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcttgggtcgaccatcaaggtagaagtaaaaactgaatatattgaagaacag
tcatctcccaaagaggagagataccttttcagatataccatcaccatcatcaacctggga
caaacagctgtcacgctagaaagtcgccactggcgtattaccgactctaatgatcataag
agtgaggtccaaggtgcgggtgtggtcggtgaaacaccaagaatagagcccgacacagca
tatcaatataccagtggaacggttttagaaacgccacttggcgtcatgcaaggcacatac
actatggtgactgatgacggtgaacaattccaagcgatcattcatccatttaggttatcc
gttccaggtttacttcattaa

DBGET integrated database retrieval system