KEGG   Shewanella psychrophila: Sps_05439Help
Entry
Sps_05439         CDS       T05063                                 

Definition
(GenBank) selenophosphate synthase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
spsw  Shewanella psychrophila
Pathway
spsw00450  Selenocompound metabolism
spsw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Sps_05439
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spsw03016]
    Sps_05439
Enzymes [BR:spsw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     Sps_05439
Transfer RNA biogenesis [BR:spsw03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Sps_05439
 Prokaryotic Type
    Sps_05439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AQS40503
UniProt: A0A1S6HY90
Position
6117133..6118173
Genome map
AA seq 346 aa AA seqDB search
MSESKIKLTEYSHGAGCGCKISPKVLGTILASQLPVFEDPKLLVGNQTRDDAAVYKLNEE
TGIISTTDFFMPIVDDPFTFGRIAATNAISDIYAMGGTPMMAIAILGWPVNTLPAEVAQQ
VVDGGRQACEDAGIMLAGGHSIDSPEPIFGLAVTGQIPLGELKKNNTAQPGDKLYLTKPL
GIGILTTAQKQKKIAPEDINIAADAMCELNLLGPAIAKISGVNAMTDVTGFGLAGHLIEM
CQGAKLNSRIQVSTLPLLTKAKAYLEMGCIPGGTHRNYDSYSEHLPSLTDEQKGIICDPQ
TSGGLLISVAPEAEQELIRLLVNNKIPTECIGTMTNASQATLVELI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaatctaaaatcaagcttaccgaatacagccatggcgctggatgtggatgtaaa
atatcaccaaaagtcctaggtactatattagcttctcagcttccggtattcgaagacccc
aagctattagtgggcaatcaaacccgagatgatgcagccgtttacaaactcaacgaagaa
accggcatcatcagcaccacagacttctttatgcccatcgtcgatgaccctttcaccttc
ggtagaatcgctgcaactaatgctatcagcgatatctatgccatgggcggcacacctatg
atggccattgcaattttgggctggccagttaataccttaccagcagaagtggctcagcaa
gttgtcgatggcgggcgtcaagcctgtgaagatgccgggatcatgttggccggtggccac
agtatcgattccccagagcccatatttgggctcgctgtaactgggcaaatcccacttggc
gagcttaagaaaaataatacagctcaacctggcgataagctctatctgactaaaccttta
ggtataggcatcttaactacagcacagaagcagaaaaaaattgcgcctgaagatatcaat
attgccgccgatgccatgtgcgaactaaatttattaggccctgcaatcgcaaaaatttcc
ggggttaatgccatgacagatgttactgggttcgggcttgccgggcatcttatcgagatg
tgccagggtgctaaactcaattcacggatccaagtttcgacgctaccactattaactaag
gctaaggcttatcttgagatgggctgtataccgggtggcacacacagaaactacgatagc
tacagcgaacatttgcctagcctcacagatgagcagaaaggcattatatgtgacccacaa
accagcggcggtttactcatatctgtagcgcccgaagccgagcaagaattaattcgcttg
ctagtcaataacaagattccaacagagtgtattggtaccatgaccaatgcgtcacaagca
acactagtggaactcatctaa

DBGET integrated database retrieval system